Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53470-AT3G14810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mechanosensitive channel of small conductance-like 4
Function (paralog2):mechanosensitive channel of small conductance-like 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3703613951581
Log2 mRNA fold difference:2.0465764123191
Log2 TE fold difference:0.3894518240764
Sequences
Protein sequence

MAVDSTDQRRDFVVRIDGEDNGDSEKFWRESSINFWHNDKSSKPPGGEEDDGSFDFMRRS
SEKSEEPDPPSKLINQFLNKQKASGDEISLDMEANMPELQKNTVPPLSSTAVSGSASPVT
APVTASYRNGTGDAIRRRQNRVTLSPSVKDGDSSEDEENRVDGSEVVKCTSNRSTMRTKT
LMKMKTRSRLMDPPTPTYPDMVSGRTPRSGNLNPGFSGRNTKPGTPNQGGSKDLEEEEDP
FSEEDLPEGLRKEKICVWVIIEWIFLILIIASLICSLVIPYLRGKTLWDLALWKWEVMVL
VLICGRLVSSWIVKLFVYFVESNFLWRKKVLYFVYGIRKPVQNCLWLGLVLIAWHFLFDK
KVEREMRSTVLKYVTKVLICLLVAVIIWLIKTLLVKVLASSFHMSTYFDRIQESLFTQYV
IETLSGPPRIEIHIEEEKVANDVKTFEIVGRKLSPLGPKAVSSPPQVTVGSGRLQKSPSR
VGKSPVLSRSGSKKEGGEEGIRIDHLQRMNTKNVSAWKMKKLMNVIKKGTLSTLDEQIQD
TTTQEDDKATQIRSEFEAKLAARKIFQNVAEPGSRYIYMEDFMRFLSEDESERAMDLFEG
ASECHKISKSCLKNWVVNAFRERRALALTLNDTKTAVNRLHRIVDVLVSIVILIIWLLIL
GIATTKFLLVISSQLLLVVFVFGNSCKTIFEAVIFVFVMHPFDVGDRCEIDGVQMIVEEM
NILTTVFLRFDNQKIVYPNSLLGTKPIANYYRSPDMQDAIEFFVHIATPPEKTTALRQRI
LSYVDNKKDHWHPSPMIVFRDMCGLNSVKIAMWPTHKMNHQNMGERYVRRGQLLEEIGRL
CRELDIEYRLYPLNINVKSLPAATPITSDRIPPSWNQQRSV

MAAVDSTDRRDFIVNINGQESGAVGATGSSSNAEGGNIWKESSYDFWDGEKGKNDKKGDD
EDEDGGSFHFRQRGERRHSSAELSDPPSKLIGQFLHKQRASGDEISLDVELNMAELQSNT
PPRPATASNTPRRGLTTISESSSPVKTKVKADAVRRRQNRTSLGGSSDEEGRNRDEAEVL
KCGSKKPMLSRNKTKSRLQDPPTPTHPAIDKTEMKSGRRSGIFKSGFLGKSPKAGTPGRN
GFEEEEEEDPFLDEDLPEEFKRDKLSFWVFLEWISLVLIVTSLVCSLTIHNLQRKTWWKL
DLWKWEVTVLVLICGRLVSSWIVRIIVFLVEKNFTWRKRVLYFVYGVRKSVQNCLWLGLV
LLAWHFLFDKKVERETRSTALRYVTRVLVCLLVALIIWLVKTILVKVLASSFHMSTYFDR
IQESLFTQYVIETLSGPPLMEIQRMEEEEQQVAEDVKSLEKLAGAKLPPALKATVKSFMK
VGKSPGLNRIGSKRGEDGEGIRIDQLKRMNTKNVSAWNMKRLMNIILKGAISTLDQNMQD
TTQEDEDATHIRSEYEAKCAARKIFHNVTEPGSRYIYLEDFLRFLCEEEAERAMALFEGA
SESDKISKSCLKNWVVKAFRERRALALTLNDTKTAVDRLHRIINVVIGIIIIIIWLLILG
IATTRFLLVLSSQLLLVAFVFGNSCKTIFEAIIFLFVMHPFDVGDRCEIDGVQLVVEEMN
ILTTVFLRYDNQKIIYPNSVLGTKPIANYYRSPDMGDAVEFCVHIATPPEKITAIKQRIL
SYVDNKKDYWYPAPMIVFLSMDDLNSVKIAVWLTHRMNHQDMGERYIRRGLLLEEVGKTC
RELDIEYRLYPLNINVRSLPPTANPTSSDRIPPSWMQQRGP

www.000webhost.com

Other information
Ka divergence:-0.258204KaKs divergence:-0.0939297
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2646Length 2 (bp):2646Length divergence:0
MFE 1 (kcal):-818.95MFE 2 (kcal):-822.69MFE divergence0.002