Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53510-AT3G14720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mitogen-activated protein kinase 18
Function (paralog2):MAP kinase 19

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.42343232613716
Log2 mRNA fold difference:0.18876154734867
Log2 TE fold difference:0.17219647013558
Sequences
Protein sequence

MQQNQVKKGTKEMEFFTEYGDANRYRILEVIGKGSYGVVCAAIDTHTGEKVAIKKINDVF
EHISDALRILREVKLLRLLRHPDIVEIKSIMLPPSKREFKDIYVVFELMESDLHQVIKAN
DDLTREHHQFFLYQMLRALKFMHTANVYHRDLKPKNILANANCKLKVCDFGLARVAFNDT
PTTVFWTDYVATRWYRAPELCGSFFSKYTPAIDVWSIGCIFAEVLTGKPLFPGKSVVHQL
ELITDLLGTPKSETISGVRNDKARKYLTEMRKKNPVTFSQKFSKADPLALRLLQRLLAFD
PKDRPTPAEALADPYFKGLSKIEREPSSQQISKMEFEFERRRLTKDDIRELIYREILEYH
PQLLKDYMSGSEGSNFVYPSAIGHLRQQFTYLEENSSRNGPVIPLERKHASLPRSTVHST
VVHSTSQPNLGATDSRRVSFEPSKNGASSAGHPSTSAYPTKSIGPPPRVPPSGRPGRVVE
SSVSYENGRNLKEAYFRSAVSSPHCYFRPNTMTNPENRNIEASSFPPKPQNPVHQFSPTE
PPAATTNQADVETMNHPNPYFQPQLPKTDQLNNNTHMAIDAKLLQAQSQFGPAGAAAVAV
AAHRNIGTISYSAAS

MQKTQEKKNMKEMEFFTEYGDANRYRILEVIGKGSYGVVCAAIDTQTGEKVAIKKINDVF
EHVSDALRILREVKLLRLLRHPDIVEIKSIMLPPSKREFKDIYVVFELMESDLHQVIKAN
DDLTREHHQFFLYQMLRALKYMHTANVYHRDLKPKNILANANCKLKVCDFGLARVSFNDT
PTTVFWTDYVATRWYRAPELCGSFCSKYTPAIDIWSIGCIFAEVLTGKPLFPGKSVVHQL
DLITDLLGTPKSETIAGVRNEKARKYLNEMRKKNLVPFSQKFPNADPLALRLLQRLLAFD
PKDRPTAAEALADPYFKCLAKVEREPSCQPISKMEFEFERRRLTKDDIRELIYREILEYH
PQLLKDYMNSEGSSFLYPSAIGHLRKQFAYLEENSGKSGPVIPPDRKHASLPRSAVHSSA
VNSNAQPSLNASDSRRVSIEPSRNGVVPSTSAYSTKPLGPPPRVPSGKPGRVVESSVTYE
NDRNLKESSYDARTSYYRSTVLPPQTVSPNCYFLPNTMNQEKRSGTEAASQPKPQFVPTQ
CNSAKPAELNPNPYVQSQHKVGIDAKLLHAQSQYGPAGAAAVAVAAHRNIGAVGYGMS

Other information
Ka divergence:-0.0812549KaKs divergence:-0.0134446
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1848Length 2 (bp):1797Length divergence:-0.014
MFE 1 (kcal):-525.53MFE 2 (kcal):-530.72MFE divergence0.005