Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53590-AT3G14590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-dependent lipid-binding (CaLB domain) family protein
Function (paralog2):Calcium-dependent lipid-binding (CaLB domain) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.1685839722215
Log2 mRNA fold difference:-1.5441585111744
Log2 TE fold difference:-0.60791122989793
Sequences
Protein sequence

MESSLIHHIIIVLLLLWFISSLNRSHAFFYFLALIYLYLVHERYVMRLKRKLQFEERKQA
NQRRVLSDSESVRWMNYAVEKIWPICMEQIASQKILGPIIPWFLEKYRPWTAKKAVIQHL
YMGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLAADDMSAILAVKLRKRLGFGMWTKLHL
TGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPIFTHGLDVAVLPGIAGWLD
KLLSIAFEQTLVQPNMLVVDMEKFVSPTSENWFFVDEKEPVAHVLVEVFEASDLKPSDLN
GLADPYVKGKLGAYRFKTKIQKKTLSPKWHEEFKIPIFTWDSPSILNIEVGDKDRFVDDT
LGECSVNIEEFRGGQRNDMWLSLQNIKMGRLHLAITVIEDNAKSSDDPLKKAKLNKEDIQ
TSFASDTTNLGSFSSDKSPSVVDNFEPIKIDGQEETAIWVQKPGAEVSQIWEPRKGKSRR
LDSQIQRTPNDESLSNGSSSTDDNQEGSKNPMKSVGRGLRKIGSMFHRNVKKEEFLIGSI
EEESQSQSPRINLKAVNQKDVGLNFIVDDNLSGPLSGKSLDGESLDAEENSGKGHMKDVA
KSFLKQAEKSAKQIKHAFSRKGSMKPRDGHKEIVPESDSGTDSESSDDDDAFTCVKNLAT
EPGKLTRDGNIERTGDDDHVDSTTLATAKEDSSGDILEDSTDVEAKEEKLKEAAESETRD
MDTAMNIKTEDEKGDTLKNIEEGEEKESSSK

MECSVIHHVVIVLLLLWVLSYLNRSHAVFYVLSLVYLYLVHERYVMRLRKKLQFEERKQA
NQRRVLSDSESVRWLNHAVERIWPICMEQIASQKILRPIIPWFLDKYRPWTAKKVVIQHL
YLGRNPPLLTDIRVLRQSTGDDHLVLELGMNFLTADDMSAILAVKLRKRLGFGMWTKLHL
TGMHVEGKVLIGVKFLRRWPFLGRLRVCFAEPPYFQMTVKPITTHGLDVAVLPGIAGWLD
KLLSVAFEQTLVEPNMLVVDMEKFVSPESGDNWFFVDEKEPVAHALVEVVEACDVKPSDL
NGLADPYVKGQLGAYRFKTKILWKTLAPKWQEEFKIPICTWDSANILNIEVQDKDRFSDD
SLGDCSVNIAEFRGGQRNDMWLPLQNIKMGRLHLAITVLEDEAKLNDDPFEGVTICKEDM
WASFASDVTNKGSFSSVVSDKSPRVPDNMEPINIEGQEETGIWVHQPGTEVSQIWEPRKG
KSRCLDNKIQCAGSVRSTASTSPNNESSSTDKNQEGKSEMKSVGWGLKKIGLVFHKNGKK
EECHHTGSIEEDIRSPRINLKALNQKDVGVKFIVEDRLSGPLTGRSPKGESFDSEDSQHK
RHMKDVAKSILKHAEKSARHLKHAFSHKGSRKSRDDECSTVSEQDSECLSETSDDKSAFS
NVQDLGTLRRAKLEGKTVKAGEDDNVNTSANSKDDSKNKETKKNLANLETTYSDARNSFA
GAEKVTTPKNRKGIIGK

Other information
Ka divergence:-0.451191KaKs divergence:-0.508982
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):2256Length 2 (bp):2214Length divergence:-0.009
MFE 1 (kcal):-629.45MFE 2 (kcal):-649.32MFE divergence0.016