Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53650-AT3G14450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CTC-interacting domain 8
Function (paralog2):CTC-interacting domain 9

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.072531474143594
Log2 mRNA fold difference:-0.82809042249608
Log2 TE fold difference:0.66958911054461
Sequences
Protein sequence

MAAITEMATDSNDVINDGGTGDGIEKSTDSKPEIESDDLKPKSKPEYDQMKKLVAMFKKL
NPEAKEFFPSYKRNTNQSDDFVIAIKPSGEDNKKVAINRRRRNNYNQGRRVRLPGRASKA
QREDSIRRTVYVSDIDQSVTEEGLAGLFSSCGQVVDCRICGDPNSVLRFAFVEFSDDQGA
RSALSLGGTMIGYYPVRVLPSKTAILPVNPTFLPRSEDEREMCSRTIYCTNVDKNATEDD
VNTFFQSACGEVTRLRLLGDQVHSTRIAFVEFAMAESAVAALNCSGIVLGSQPIRVSPSK
TPVRSRITRSPSPN

MATVTEMPTDVVVVDDVKEVSTKSEKIIDEGIEKSSITDSKTETESRLDMHKLVAMFKKL
NPLAKEFFPSYYDPKKNNQVAKANQFLPADDFETTKKQSGEEFDLDAKKDDNTRKRRNYS
QGRRRLTGRISKAQREDSIRRTVYVSDIDQSVTEEGLAGLFSNCGQVVDCRICGDPHSVL
RFAFVEFADDQGAHEALSLGGTMLGFYPVRVLPSKTAILPVNPTFLPRSEDEREMCTRTI
YCTNIDKKVSQADVRNFFESACGEVTRLRLLGDQLHSTRIAFVEFALADSALSALNCSGM
VVGSQPIRVSPSKTPVRPRITRPPSTN

Other information
Ka divergence:-0.0239265KaKs divergence:-0.406927
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):945Length 2 (bp):984Length divergence:0.02
MFE 1 (kcal):-283.95MFE 2 (kcal):-289.1MFE divergence0.009