Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53700-AT3G14370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):WAG 1
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.23239714496186
Log2 mRNA fold difference:-0.55962700757481
Log2 TE fold difference:1.1903482368593
Sequences
Protein sequence

MEDDGYYLDTDLDLSFTSTATDRTFTSSSARSSLARSSLTLSFNDRLSTATTPSTTTSSA
ATTLHHRRYDPHWTSIRAATTLSSDGRLHLRHFKLVRHLGTGNLGRVFLCHLRDCPNPTG
FALKVIDRDVLTAKKISHVETEAEILSLLDHPFLPTLYARIDASHYTCLLIDYCPNGDLH
SLLRKQPNNRLPISPVRFFAAEVLVALEYLHALGIVYRDLKPENILIREDGHIMLSDFDL
CFKADVVPTFRSRRFRRTSSSPRKTRRGGGCFSTEVEYEREEIVAEFAAEPVTAFSKSCV
GTHEYLAPELVAGNGHGSGVDWWAFGIFLYEMLYGTTPFKGGTKEQTLRNIVSNDDVAFT
LEEEGMVEAKDLIEKLLVKDPRKRLGCARGAQDIKRHEFFEGIKWPLIRNYKPPEIRGLV
KKTKAHAGHVTAAVTPRRNKWLWWALSHLLRSKSLSKSSSKIQSNNNYYHYVGKKL

MEQEDFYFPDTDLDLSFTSTTTDRTFASSSARTSLTLSFNDRLSTSSAVTTSSTSSSSVN
HRRHDPHWSAIKSAKLLSSDGNIHLRHLKLIRHLGTGNLGRVFLCNLRDSSARFALKVID
RNCLTTEKKLSQVETEAEILSLLDHPFLPTLYARIDESHYTCLLIDYAPNGDLHSLLRKQ
PGNRLPIQPVRFFAAEVLVALEYLHAMGIVYRDLKPENVLLREDGHVMLSDFDLCFKSDV
VPTFKSRRYRRSSSSPSLRRRRSGCFSVAAEKKYEREEIVSEFAAEPVTAFSRSCVGTHE
YLAPELVSGNGHGSGVDWWAFGIFLYELLYGTTPFKGESKEQTLRNIVSTTKTASFHMDG
DLDEARDLIEKLLVKDPRKRLGCARGAQDIKRHPFFDGIKWPLIRHYKPPEEVRGLVIKK
STRPHASHVIAVSPRRRKSFLWRALSYLLRGKSSSGGSKNQSNSNYYHYVGKSYASRKRV

Other information
Ka divergence:-0.00933323KaKs divergence:0.286863
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1431Length 2 (bp):1443Length divergence:0.004
MFE 1 (kcal):-449.92MFE 2 (kcal):-448.5MFE divergence-0.002