Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53830-AT3G14310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):pectin methylesterase 2
Function (paralog2):pectin methylesterase 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.72432674093004
Log2 mRNA fold difference:1.2255539968095
Log2 TE fold difference:-0.50325038463652
Sequences
Protein sequence

MAPIKEFISKFSDFKNNKKLILSSAAIALLLLASIVGIAATTTNQNKNQKITTLSSTSHA
ILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRK
GLTPREVTALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGT
CLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKSSTFTNNN
NRKLKEVTGDLDSDGWPKWLSVGDRRLLQGSTIKADATVADDGSGDFTTVAAAVAAAPEK
SNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAV
GERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHI
TGTVDFIFGNAAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDL
LAVKGTFPTYLGRPWKEYSRTVIMQSDISDVIRPEGWHEWSGSFALDTLTYREYLNRGGG
AGTANRVKWKGYKVITSDTEAQPFTAGQFIGGGGWLASTGFPFSLSL

MAPSMKEIFSKDNFKKNKKLVLLSAAVALLFVAAVAGISAGASKANEKRTLSPSSHAVLR
SSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRKGLT
PREKTALHDCLETIDETLDELHETVEDLHLYPTKKTLREHAGDLKTLISSAITNQETCLD
GFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEE
NQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVKADATVAADGSGTFKTVAAAVA
AAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSA
TVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFF
VKCLIAGTVDFIFGNAAVVLQDCDIHARRPNSGQKNMVTAQGRTDPNQNTGIVIQKCRIG
ATSDLQSVKGSFPTYLGRPWKEYSQTVIMQSAISDVIRPEGWSEWTGTFALNTLTYREYS
NTGAGAGTANRVKWRGFKVITAAAEAQKYTAGQFIGGGGWLSSTGFPFSLGL

www.000webhost.com

Other information
Ka divergence:-0.11467KaKs divergence:-0.355402
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):1764Length 2 (bp):1779Length divergence:0.004
MFE 1 (kcal):-558.3MFE 2 (kcal):-606.59MFE divergence0.041