Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53850-AT3G14290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):20S proteasome alpha subunit E1
Function (paralog2):20S proteasome alpha subunit E2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.68797799053225
Log2 mRNA fold difference:-0.16505763342965
Log2 TE fold difference:-0.55552456324445
Sequences
Protein sequence

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLE
PSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLA
LRFGEGEEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQ
EQFNKDLSLQEAETIAVSILKQVMEEKVTPNNVDIAKVAPAYHLYTPQEVEAVIARL

MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLE
PSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLA
LRFGEGEEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQ
EQFNKDITLQEAETIAVSILKQVMEEKVTPNNVDIAKVAPAYHLYTPQEVEAVISRL

www.000webhost.com

Other information
Ka divergence:-0.338188KaKs divergence:-0.638889
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):714Length 2 (bp):714Length divergence:0
MFE 1 (kcal):-219.3MFE 2 (kcal):-217.12MFE divergence-0.005