Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53870-AT3G14260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF567)
Function (paralog2):Protein of unknown function (DUF567)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.7104823458547
Log2 mRNA fold difference:2.5045494201801
Log2 TE fold difference:0.061369669298471
Sequences
Protein sequence

MQIYNPISPVKTMVKIYPHLAFPVDMDVVQDKILPYLTTEQERFTIWMKSLVFNSKGCTV
FDSKGNLIYRVDNYDSKSWSNEVYFMDLNGKILFTLRQKKLGFFKSWEGYNSTGTRFRLR
KIFKILPRESSSSYKVVMGSRIVDGDQQSCYKIVNRGSVFAIKDGSGRLMAEVKNKLSDI
SGLDLGDDVLTMMVEPQLDHSLIMGIVIAYKLTKCKL

MQIYRRPFETKTWQYRICPAETMVKIHPDLTTSGAGEETSSPYLTTEQESFTIWMKSLVF
NTNGCTVFDSKGNIIYRVDNYNSKSCREVYLMDLSGHVLFTLRRQKFGLFKTWEGYRSSS
ATVESTTKLEYFRVKNNVFQVPNKDSSSSYRVNAGSCRNDEQYCYKMVTRGSSLAIEDNC
GKLLAEVKRKQSINGLKLGDDVLTMMVESQVDHSFIIGLVLAHSLINCIL

Other information
Ka divergence:0.000319616KaKs divergence:0.297834
GC content 1 (%):36GC content 2 (%):38GC content divergence:0.027
Length 1 (bp):654Length 2 (bp):693Length divergence:0.029
MFE 1 (kcal):-174.6MFE 2 (kcal):-177.4MFE divergence0.008