Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G53910-AT3G14230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):related to AP2 12
Function (paralog2):related to AP2 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.33869040852931
Log2 mRNA fold difference:-0.59250153141504
Log2 TE fold difference:0.28566984782969
Sequences
Protein sequence

MCGGAIISDFIPPPRSRRVTSEFIWPDLKKNLKGSKKSSKNRSNFFDFDAEFEADFQGFK
DDSSIDCDDDFDVGDVFADVKPFVFTSTPKPAVSAAAEGSVFGKKVTGLDGDAEKSANRK
RKNQYRGIRQRPWGKWAAEIRDPREGARIWLGTFKTAEEAARAYDAAARRIRGSKAKVNF
PEENMKANSQKRSVKANLQKPVAKPNPNPSPALVQNSNISFENMCFMEEKHQVSNNNNNQ
FGMTNSVDAGCNGYQYFSSDQGSNSFDCSEFGWSDQAPITPDISSAVINNNNSALFFEEA
NPAKKLKSMDFETPYNNTEWDASLDFLNEDAVTTQDNGANPMDLWSIDEIHSMIGGVF

MCGGAIISDFIPPPRSLRVTNEFIWPDLKNKVKASKKRSNKRSDFFDLDDDFEADFQGFK
DDSAFDCEDDDDVFVNVKPFVFTATTKPVASAFVSTGIYLVGSAYAKKTVESAEQAEKSS
KRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFDTAEEAARAYDAAARRIRGTKAK
VNFPEEKNPSVVSQKRPSAKTNNLQKSVAKPNKSVTLVQQPTHLSQQYCNNSFDNSFGDM
SFMEEKPQMYNNQFGLTNSFDAGGNNGYQYFSSDQGSNSFDCSEFGWSDHGPKTPEISSM
LVNNNEASFVEETNAAKKLKPNSDESDDLMAYLDNALWDTPLEVEAMLGADAGAVTQEEE
NPVELWSLDEINFMLEGDF

Other information
Ka divergence:-0.0358588KaKs divergence:0.200563
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):1077Length 2 (bp):1140Length divergence:0.028
MFE 1 (kcal):-343.35MFE 2 (kcal):-366.7MFE divergence0.033