Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54000-AT3G14210
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):GDSL-like Lipase/Acylhydrolase superfamily protein
Function (paralog2):epithiospecifier modifier 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:5.996538741462
Log2 mRNA fold difference:7.2891515860053
Log2 TE fold difference:-1.3585829069118
Sequences
Protein sequence

MMANNCNLVSVLCVILVLTLFHNPITVAGQNSPVVALFTFGDSNFDAGNKQTLTKTLVAQ
GFWPYGKSRDDPNGKFSDGLITPDFLAKFMKIPLAIAPALQPNVNVSRGASFAVEGATLL
GAPVESMTLNQQVKKFNQMKAANWNDDFVAKSVFMIYIGANDYLNFTKNNPTADASAQQA
FVTSVTNKLKNDISALYSSGASKFVIQTLAPLGCLPIVRQEYNTGMDQCYEKLNDLAKQH
NEKIGPMLNEMARNSPASAPFQFTVFDFYNAVLTRTQRNQNFRFFVTNASCCGVGSHDAY
GCGLPNVHSKLCEYQRSFLFFDGRHNSEKAQEMFAHLLFGADTNVVQPMNVRELTVYPVD
EPMREFWVPPTPATVHASDSSSSTSRGYEYY

MADNLNLVSVLGVLLVLTIFHNPIIVYAGEGVPNVALFTFGDSYYDAGNKVFLSQRKDLP
QTYWPYGKSRDYPNGKFSDGHIVPDFIADFISIPNGVLPPVLKPGVDISRGVSFAVADAS
ILGAPVESMTLNQQVVKFKNMKSNWNDSYIEKSLFMIYIGTEDYLNFTKANPNADASAQQ
AFVTNVINRLKNDIKLLYSLGASKFVVQLLAPLGCLPIVRQEYKTGNECYELLNDLAKQH
NGKIGPMLNEFAKISTSPYGFQFTVFDFYNAVLRRIATGRSLNYRFFVTNTSCCGVGTHN
AYGCGKGNVHSKLCEYQRSYFFFDGRHNTEKAQEEMAHLLYGADPDVVQPMTVRELIVYP
TGETMREYWEPNNLAIRRRPSRDFYLGLAAYY

www.000webhost.com

Other information
Ka divergence:-0.180382KaKs divergence:-0.408307
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1176Length 2 (bp):1179Length divergence:0.001
MFE 1 (kcal):-329.66MFE 2 (kcal):-341.6MFE divergence0.018