Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54060-AT3G14180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):6B-interacting protein 1-like 1
Function (paralog2):sequence-specific DNA binding transcription factors

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.15937279559775
Log2 mRNA fold difference:-0.64324933368842
Log2 TE fold difference:0.38761555822704
Sequences
Protein sequence

MEDDDEIQSIPSPGDSSLSPQAPPSPPILPTNDVTVAVVKKPQPGLSSQSPSMNALALVV
HTPSVTGGGGSGNRNGRGGGGGSGGGGGGRDDCWSEEATKVLIEAWGDRFSEPGKGTLKQ
QHWKEVAEIVNKSRQCKYPKTDIQCKNRIDTVKKKYKQEKAKIASGDGPSKWVFFKKLES
LIGGTTTFIASSKASEKAPMGGALGNSRSSMFKRQTKGNQIVQQQQEKRGSDSMRWHFRK
RSASETESESDPEPEASPEESAESLPPLQPIQPLSFHMPKRLKVDKSGGGGSGVGDVARA
ILGFTEAYEKAETAKLKLMAELEKERMKFAKEMELQRMQFLKTQLEITQNNQEEEERSRQ
RGERRIVDDDDDRNGKNNGNVSS

MEDDEDIRSQGSDSPDPSSSPPAGRITVTVASAGPPSYSLTPPGNSSQKDPDALALALLP
IQASGGGNNSSGRPTGGGGREDCWSEAATAVLIDAWGERYLELSRGNLKQKHWKEVAEIV
SSREDYGKIPKTDIQCKNRIDTVKKKYKQEKVRIANGGGRSRWVFFDKLDRLIGSTAKIP
TATSGVSGPVGGLHKIPMGIPMGSRSNLYHQQAKAATPPFNNLDRLIGATARVSAASFGG
SGGGGGGGSVNVPMGIPMSSRSAPFGQQGRTLPQQGRTLPQQQQQGMMVKRCSESKRWRF
RKRNASDSDSESEAAMSDDSGDSLPPPPLSKRMKTEEKKKQDGDGVGNKWRELTRAIMRF
GEAYEQTENAKLQQVVEMEKERMKFLKELELQRMQFFVKTQLEISQLKQQHGRRMGNTSN
DHHHSRKNNINAIVNNNNDLGNN

www.000webhost.com

Other information
Ka divergence:-0.519316KaKs divergence:0.918502
GC content 1 (%):46GC content 2 (%):50GC content divergence:0.042
Length 1 (bp):1152Length 2 (bp):1332Length divergence:0.072
MFE 1 (kcal):-378.09MFE 2 (kcal):-460.33MFE divergence0.098