Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54080-AT3G14100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):oligouridylate-binding protein 1A
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.15293802950862
Log2 mRNA fold difference:0.71125845726387
Log2 TE fold difference:-0.34833902224975
Sequences
Protein sequence

MQNQRLIKQQQQQQQQQHQQAMIQQAMMQQHPSLYHPGVMAPPQMEPLPSGNLPPGFDPT
TCRSVYAGNIHTQVTEILLQEIFASTGPIESCKLIRKDKSSYGFVHYFDRRCASMAIMTL
NGRHIFGQPMKVNWAYATGQREDTSSHFNIFVGDLSPEVTDAALFDSFSAFNSCSSYYRD
ARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWATKGATFGEDKHS
SDGKSVVELTNGSSEDGRELSNEDAPENNPQFTTVYVGNLSPEVTQLDLHRLFYTLGAGV
IEEVRVQRDKGFGFVRYNTHDEAALAIQMGNAQPFLFSRQIRCSWGNKPTPSGTASNPLP
PPAPASVPSLSAMDLLAYERQLALAKMHPQAQHSLRQAGLGVNVAGGTAAMYDGGYQNVA
AAHQQLMYYQ

MQNPRLKQHQQQQQQQAMMQQQALMQQHSLYHPGVLAPPQLEPVPSGNLPPGFDPSTCRS
VYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRH
LFGQPIKVNWAYATGQREDTSSHFNIFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQK
TGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKGATSGDDKLSSDGKSVVE
LTTGSSEDGKETLNEETPENNSQFTTVYVGNLAPEVTQLDLHRYFHALGAGVIEEVRVQR
DKGFGFVRYNTHPEAALAIQMGNTQPYLFNRQIKCSWGNKPTPPGTASNPLPPPAPAPVP
GLSAADLLNYERQLALSKMASVNALMHQQGQHPLRQAHGINAAGATAAMYDGGFQNVAAA
QQLMYYQ

www.000webhost.com

Other information
Ka divergence:-0.392029KaKs divergence:-0.110653
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1293Length 2 (bp):1284Length divergence:-0.003
MFE 1 (kcal):-388.7MFE 2 (kcal):-394.12MFE divergence0.007