Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54090-AT3G14090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):exocyst subunit exo70 family protein D2
Function (paralog2):exocyst subunit exo70 family protein D3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.51790165456804
Log2 mRNA fold difference:-0.79966938067014
Log2 TE fold difference:0.22650384453999
Sequences
Protein sequence

MATPETRGVDSDLETAEKIILRWDSTTSEEAKENLIFQSGGDREEVDRYLKAVDEVQRHI
SSISISDEVKATIQIAMARLEDELRNILISQTSTFEPDSLLLDSSLSSSSFASSSRTELE
DDTCDDGNEEEEQQQVDLVLPDGSGSDSGSRRLSRSRRSNSKSTSSIREIDLVTPEAVSD
LRSIAQRMIGAGYSRECVQVYGNVRKSAMEMIFKQLGIVKLGIGDVQRLDWEAVEVKIRR
WIRAAKVCVRVVFASEKRLCEQIFEGTMEETCFMEIVKTSALQLFNFPEAISISRRSPEK
LFKILDLHDAITDLLPDMEEIFDSSSSESILVQATEIQSRLAEAARGILTEFENAVFREP
SVVPVPGGTIHPLTRYVMNYLNLISDYRETLIDLVMTKPCRGLKCTNDRNDPDMDISELE
GISPLALHMIWTMVMLQFNLEEKSLHYRDEPLSHIFVMNNVHYIVQKVKSSPELMELIGD
KYLRKLTGIFRQAATKYQRATWVRVLNSLRDEGLHVSGSFSSGVSKSALRERFKAFNTMF
EEVHRIQSTWSVPDTQLREELRISLSEHLIPAYRSFLGRFRGHIESGRHPENYLKYSVEN
LETAVLDFFEGYTTAPHLRRSQ

MEPPENSLDSDGSNLETAERIILRWDSAATDGARGKMIFQSDRDEVDRFLRAVDEIQRSL
SSVSFSSSSSSAATSAATVVDEHEVKANSAIQIAMARLEDEFRNILLSHTTTFEPDSLFL
EEPSVSPSLTVEVGEDTTVTPEEEELNSPGGSGSSRLTRRRSSYRSTSSIREMDLISPEA
VSDLRSIVQRMVAAGYSRECIQVYGTVRKSAMEAIFKQLGIVKISIGDVQRLEWEVVEGK
IRKWIRAAKVCIRVVFSSEKRLCEQLFDGICTAMDETCFMETVKASALRLFTFPEAISIS
RRSPEKLFKILDLHDALTDMLPDIEAIFDSDSSDAIRAQAVEIQSRLAEAARGILSEFEN
AVLREPSIVPVPGGTIHPLTRYVMNYIVMISDYKQTLDDLIMSNPSTGSDPNTPDMDFTE
LDSKSPLDLHLIWLIVVLHFNLEEKSKHYRDTSLAHIFIMNNIHYIVQKVKRSPELREMI
GDHYLRKLTGIFRHAATNYQRATWVRVLNSLRDEGLHVSGSFSSGVSRSALRERFKAFNT
MFEEVHRTQSTWSVPDAQLREELRISLSEHLIPAYRSFLGRFRGHIESGRHPENYLKYSV
EDIETIVLDFFEGYTTPPHLRRR

www.000webhost.com

Other information
Ka divergence:-0.155282KaKs divergence:-0.0583704
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1869Length 2 (bp):1872Length divergence:0.001
MFE 1 (kcal):-569.86MFE 2 (kcal):-568.13MFE divergence-0.002