Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54115-AT3G14070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cation calcium exchanger 4
Function (paralog2):cation exchanger 9

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.4319036628465
Log2 mRNA fold difference:-3.105313498639
Log2 TE fold difference:0.739357501617
Sequences
Protein sequence

MRAVNFMYSSNNPKFRGIFNGLCAIILFIFFFDQSDIYRNPLLKNLSFVDSSGKFNRGFS
QFTVPRRHLSEVDTNGSSGNSSLSGDSTVSCSGLHEHRGYADQCEFLKSNPICSPDGFFD
YLKFFYCSCRDFKILGYILLGVWLVALFYLLGNTAADYFCCSLEKLSKLLRLPPTVAGVT
LLPLGNGAPDVFASIAAFVGSDKGEVGLNSVLGGAVFVTCVVVGIVSLCVADKEVKIDKK
CFIRDLSFFLFTLVALMVILMVGKVTVGIAIAFVSIYVFYASLVAANEILRKHSRRLKLD
SITPLLPMQGSVFSSPSVEEDIPMYSPLMELDTGEGPPRLHDSLPQWMWATNVAIYSNHF
AKANVHDEERPPWGWTEDGAEVESSLCSKITSLLETPLTVPRRLTIPLIEEDSWSKTYAV
ASVSLAPVLLSFLWSSQDDTSLQARIVAYFIGIAIGSTLGYLAFKNTEPDRPPQIYLIPW
VLGGFIMSIVWFYMIANELVALLVTFGGIYGINPSILGLTVLAWGNSMGDLVSNIALSMN
GGDGVQIALSGCYAGPMFNTLVGLGMSMFLGAWSKSPETYMIPEDNSLFYTLGFLIFGLI
WSLVMLPRNEMRPNKVMGIGLITLYLIFVTFRLSSAMGFIPWAS

MSAVSFLYSSKTPKFRGVFNGICALVLFCFFFDRSELLRNPLLRNASFVNGGSGSTSGGI
TQFMVIRRNARQIETNGSGNNSSLSSSSTVLCSGLHKHMGYADQCEFLKANPICSPDGFF
DYLSFFYCSCRDFSILGYMMLGVWLVALFYLLGNTAADYFCCSLEKLSKLLRLPPTVAGV
TLLPLGNGAPDVFASIAAFVGTDKGEVGLNSVLGGAVFVTSVVVGIVSLCVADKEVKIDK
NCFIRDLSFFLFSLVSLLVILMVGRVTVRIAIAFVSIYVVYAFLVAANVILRKHAKRFKL
EALTPLLPMQGSVFSPSVGEDMPMNTPLIETETEDGPPRLQSLPQWMWASNVAIYSNHFA
KVSVHDEDRPPWGWIDDTAEVESSSCTKFTSLLEIPLTIPRRLTIPSVEEDTWSKTYAVA
SVSLAPVLLASLWSSQDDVSLQACGVAYFFSVVIGSTLGFLAYKNTEPDHPPRRFLIPWV
LGGFIMSIVWFYMIANELVALLVTFGEIYGINPSILALTVLAWGNSMGDLVSNIALTMNG
GDGVQIALSGCYAGPMFNTLVGLGMSMLFGAWSKSPDTYMLPEDKSLFYTLGFLVLGLVW
AMVILPRNDMQPSRTLGVGLIAIYLIFVTFRLSCAMGFIPWAA

Other information
Ka divergence:0.159231KaKs divergence:0.064176
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1935Length 2 (bp):1932Length divergence:-0.001
MFE 1 (kcal):-576.59MFE 2 (kcal):-608.32MFE divergence0.027