Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54120-AT3G14060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0843446234235
Log2 mRNA fold difference:-1.7180168327977
Log2 TE fold difference:0.19850338171775
Sequences
Protein sequence

MDQRIAAIPVFRWSRSRRKIHIRRRKSQVVRLGGKNSAVSRGGFSLKKMVRRMKLRWLKL
HYVRVVKKIKVFYRNLVKEFVDAGAELEAIQQRMAVEAAAFAVPGLGLSFSSFSVHDRAR
YFLV

MDPHLVITAASSAFRWPSSRRKIYLRRRKPQVVRLGGKNSTPRGSFSLKKVVTRMRLKWL
RLYYVRLVKKIKAYYRTIVKEFEEAGAATIQQRMTVETAAFAAPGLGLSFCPMSGYVDQP
RFFLV

www.000webhost.com

Other information
Ka divergence:0.139816KaKs divergence:-0.999829
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):375Length 2 (bp):378Length divergence:0.004
MFE 1 (kcal):-111.1MFE 2 (kcal):-119.9MFE divergence0.038