Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54170-AT3G14010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CTC-interacting domain 3
Function (paralog2):CTC-interacting domain 4

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.218921317687
Log2 mRNA fold difference:1.1605991735173
Log2 TE fold difference:0.053790190100865
Sequences
Protein sequence

MKPVLHSGSSSNGFSHRRFEKEAWMNNAQPSVDNTENGWDAESVDTPSQKLLVYFTTCNI
GHQVEVHLKNGSVYSGIFHAANVEKDFGIILKMACLIRDSRGTKSRTVSKPSSKLLKIPA
DELVQVIAKDLPLSSDSVSDSVQCEKPLELLTDSLISQFYNVDLERELKPWVPDEDVPDC
SDLENVFDDPWKRGWNQFEVNKTLFGVTSTFDEELYTTKLERGPGTRELEEQALRIAREI
VGENTRDIHVAEERGLQLSGKFDIDEETKYSSVCATNRFDDTCYEDDEEEEEDILLDCCN
NLTFGDSSASDGKEPASTGKFYEDSWGDSLHLRSNKMVDQSWSNSNKHTRQLMSELPSKD
FPVAGNNIRNESQLGEQRKSKFLGASLFKKPSEESVSGFEDAPPPVKPSFIDGRLGLLSD
RAKSENSSGWPGSSISRNSENSAASSASNLPILSPSSSGSLSSEKSTLNPNAKEFKLNPN
AKSFKPSPSATRPQSPQSPVFDGSFYYPPVPPMPGLHIRYGTGAAFPGQQHPMMYNNTTQ
LSPNQTYYSPNSPQYPQPMMVTQQRPILFMPPTPYQPEMPYKGRDSY

MSIPQSKSSSNGFPLKRGETEEVLHKTNTSNTVFNGEAGSLKRLSLDRLVYFTTCKIGHH
VEVHLRNGSVYTGIFHAANVEKDFGIILKMACLIKDGTLRGHKSRSEFVRKPPSKTFIIP
ADELVQVIAKDLSVSSNNMSNAVQGEKPSELLTDSSISQSYHVDRERQLQRWVPDETIPH
GADLENVFDNPWNRKWNQFEVNKSLFGVKSTFDEDLYTTRLERGPQTKQLEEHAQKIARE
IEAETTRDIHVAEERGLQLNENFDFDEEARYSSVRPVTGFGDSGFDLEDNALLDTCNDLT
FGGSSTSDGQKPASSGKGCEELRVSGDSQSSRKNKNVDQSCSTSKQQSKDFPAAGSNISE
SQLDEQRRKNNEEVSHNNRSAEESTSGHGDIKEGAKSGGGASSVSKAVTEREREASQVSS
KTKSESSFGQSASRSSESRPGPSTSSRPGLSPSSSIGSMASSEKSTLNPNAKEFKLNPKA
KSFKPLQSAAAPPQSPIADASFYYPGPSHVPVQQMPGMPPVNYGLPPYPGNQPQMMYHPQ
AYYHPNGQPQYPQQQMIPGQQQQQMIPGQQHPRPVYYMHPPPYPQDMPYHNKGRE

Other information
Ka divergence:-0.0106209KaKs divergence:0.389834
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1764Length 2 (bp):1788Length divergence:0.007
MFE 1 (kcal):-517.84MFE 2 (kcal):-542.58MFE divergence0.023