Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54180-AT3G14000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BREVIS RADIX-like 3
Function (paralog2):DZC (Disease resistance/zinc finger/chromosome condensation-like region) domain containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.3186763153992
Log2 mRNA fold difference:1.2713841657906
Log2 TE fold difference:0.10539850462433
Sequences
Protein sequence

MLTCIACTKQLNTNNGGSTREEDEEHGVIGTPRTKQAIKSLTSQLKDMAVKASGAYKNCK
PCSGTTNRNQNRNYADSDAASDSGRFHYSYQRAGTATSTPKIWGNEMESRLKGISSEEGT
PTSMSGRTESIVFMEDDEVKEWVAQVEPGVLITFVSLPQGGNDLKRIRFRSTRFPYYRDQ
LLLWCRQGWVFWPQNCREMFNKWQAQKWWVENFEKVMELYNVQFNQQSVPLQTPPVSEDG
GSQIQSVKDSPVTPPLERERPHRNIPGSSGFASTPKLSSISGTKTETSSIDGSARSSSVD
RSEEVSVSNASDMESEWVEQDEPGIYITIRALPDGNRELRRVRFSRDKFGETHARLWWEQ
NRARIQQQYL

MLTCIACTKQLNTNNGGSKKQEEDEEEEDRVIETPRSKQIKSLTSQIKDMAVKASGAYKS
CKPCSGSSNQNKNRSYADSDVASNSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGE
GTPESMSGRTESTVFMEEEDELKEWVAQVEPGVLITFVSLPEGGNDMKRIRFSREMFDKW
QAQKWWAENFDKVMELYNVQQFNQQSVPLPTPPRSEDGSSRIQSTKNGPATPPLNKECSR
GKGYASSGSLAHQPTTQTQSRHHDSSGLATTPKLSSISGTKTETSSVDESARSSFSREEE
EADHSGEELSVSNASDIETEWVEQDEAGVYITIRALPDGTRELRRVRFSREKFGETNARL
WWEQNRARIQQQYL

Other information
Ka divergence:-0.132237KaKs divergence:0.400148
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1113Length 2 (bp):1125Length divergence:0.005
MFE 1 (kcal):-346.24MFE 2 (kcal):-331.5MFE divergence-0.022