Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54200-AT3G13980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.2631030912114
Log2 mRNA fold difference:0.11908905077019
Log2 TE fold difference:-2.0825997430162
Sequences
Protein sequence

MDPWDTYNIPLDHQHRLRNRRDHRHPSFSSTLLDQIYRSIDDSSTNSSSMRKTKHQNRED
TRVSANRRDDFNRSKNLKTIEPVFFKHSSSSSSDSSGFSSSESDYFYRRSKSSPAISHPK
PIRTTVERFERSPQNHRPNSSNKQEHGSFLKTKSKALKIYSDLKKVKQPISPGGRLATFL
NSIFTGAGNTKKLNKINTTVTSTTAAAAAASSTTTCSSASSFSRSCLSKTPSSSEKSKRS
VRFCPVNVIFDEDSSKYNNKNNKVYGNNEREYESIRHTLENRVMEENRRVIEAAKELLRS
YQKKNKEVIEVSVEDDEEDDDDDALSCTSSDLFELDNLSAIGIDRYREELPVYETTRLNT
NRIISR

MEITWEKPKSSSHHRNPSFSSTLLDQIYRSIDDSSPPPPLESIKKKKHHHQQRNASLHED
REISPIYHRRSIAADFERSRRKTDFLRHSNSSSSDSSGFSSSESDSFHGRSKSSASPPSS
SRQQPKPIRTSSVDHSSAVQKPKELGGFLRTKSKALKIYSDLKKVKQPISPGGRLATFLN
SLFTNAATNPKKHKKTTTVAVVEEPHSSSTCSSASSFSRSCLSKTPSSSGKSKRSVRFCP
VNVILDEDSSFTMPYAYNNERLYDNNEAKRVEEHRRVIQAAKDLLRTYHNKNKVTTTNIN
NVEEDDEDDAASCASSDLFELENLSAIGIERYREELPVYETTRLDNMNRVIATGLIV

www.000webhost.com

Other information
Ka divergence:0.127453KaKs divergence:0.486512
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1101Length 2 (bp):1074Length divergence:-0.012
MFE 1 (kcal):-258.67MFE 2 (kcal):-249.91MFE divergence-0.017