Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54210-AT3G13970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin-like superfamily protein
Function (paralog2):Ubiquitin-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.2169520647733
Log2 mRNA fold difference:-0.86347154525008
Log2 TE fold difference:-0.1239133120967
Sequences
Protein sequence

MATESSSPSSVRKVVVHLRATGGAPILKQSKFKIPGTDKFAKVIDFLRRQLHSDSLFVYV
NSAFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG

MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNS
AFSPNPDESVIDLYNNFGFDGKLVVNYACSMAWG

Other information
Ka divergence:1KaKs divergence:0.998152
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):291Length 2 (bp):285Length divergence:-0.01
MFE 1 (kcal):-72.8MFE 2 (kcal):-71.55MFE divergence-0.009