Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54270-AT3G13920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):eif4a-2
Function (paralog2):eukaryotic translation initiation factor 4A1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7212387450698
Log2 mRNA fold difference:1.8040284458895
Log2 TE fold difference:-0.052549916903469
Sequences
Protein sequence

MAGSAPEGTQFDTRQFDQRLNEVLDGQDEFFTSYDEVHESFDAMGLQENLLRGIYAYGFE
KPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDYALLQCQALVLAPTRELA
QQIEKVMRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPD
CIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRI
LVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS
RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPE
NYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL

MAGSAPEGTQFDARQFDQKLNEVLEGQDEFFTSYDDVHESFDAMGLQENLLRGIYAYGFE
KPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVLQQLDFSLIQCQALVLAPTRELA
QQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLKRQSLRAD
NIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRI
LVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRS
RDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPE
NYLHRIGRSGRFGRKGVAINFVTRDDERMLCLRTWPICCEGRKEVGSVAVFALPY

Other information
Ka divergence:0.620984KaKs divergence:-0.99989
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1239Length 2 (bp):1248Length divergence:0.004
MFE 1 (kcal):-416.4MFE 2 (kcal):-435.84MFE divergence0.023