Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54580-AT1G54630
Species:Arabidopsis
Duplication type:TD
Function (paralog1):acyl carrier protein 2
Function (paralog2):acyl carrier protein 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.024745336888955
Log2 mRNA fold difference:0.21208478625366
Log2 TE fold difference:-0.23644482524677
Sequences
Protein sequence

MASIAASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKPETVD
KVCAVVRKQLSLKEADEITAATKFAALGADSLDTVEIVMGLEEEFGIEMAEEKAQSIATV
EQAAALIEELLFEKAK

MASIATSASTSLQARPRQLVIGAKQVKSFSYGSRSNLSFNLRQLPTRLTVYCAAKPETVD
KVCAVVRKQLSLKEADEITAATKFAALGADSLDTVEIVMGLEEEFGIEMAEEKAQSIATV
EQAAALIEELLLEKAK

www.000webhost.com

Other information
Ka divergence:0.973231KaKs divergence:-0.999606
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):411Length 2 (bp):411Length divergence:0
MFE 1 (kcal):-140.9MFE 2 (kcal):-123.52MFE divergence-0.066