Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G54840-AT1G54850
Species:Arabidopsis
Duplication type:TD
Function (paralog1):HSP20-like chaperones superfamily protein
Function (paralog2):HSP20-like chaperones superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.353672638859
Log2 mRNA fold difference:1.5189993905511
Log2 TE fold difference:-0.13044697366905
Sequences
Protein sequence

MSDTMPEIVSPLVAENSQEQEESVLISLDIEEDKLFLLHFIIGTYFGPDLRKQHHRPKQS
AFQIQALKNVVVDELSGSLMKRAELERVYYHIIRNVDPSLVMKPKKLREYFNAKRNDSNR
DYPLFVDLFPRKLHPETHVRHKFKFIRSIVFINDPDTSCMREECVARFKRLTGLDSFALS
LSVDVTKSNGVVAANEVKVEIDESVEPVKEDNAGTCTSGEESDVAAKPEVKSEAHGGLMV
GLMDIGECDDAYLFRVSLPGVKRDERYFSCEVEDNGKVLVRGVTTTGGKRVKRYSHVFEM
QTRSLCPPGNFSVSFRLPGPVHPHEFSGNFGTDGILEGVVMKNLQKQTV

MRSSSGLNGMRENNSFPDNTRNPQILEVTPLNSMPYIGPVTHASMSSNRMNDSVEKVGGP
AMIFLPSDSSSEFSNLISQTKTGVALTGSAAMGKIGLTIGLVDIAESEDSYYFRVALPGV
SRDEKEFSCEIEPDGKIMIKGATTTGEQTVCKHNQIFKMLTQNLCPPGHFTINFQLPGPV
SNEEFNGNFGSDGVLEGVVKKVYYED

www.000webhost.com

Other information
Ka divergence:-0.257005KaKs divergence:0.875
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1050Length 2 (bp):621Length divergence:-0.257
MFE 1 (kcal):-286.33MFE 2 (kcal):-166.2MFE divergence-0.265