Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55110-AT3G13810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):indeterminate(ID)-domain 7
Function (paralog2):indeterminate(ID)-domain 11

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.1398274449074
Log2 mRNA fold difference:0.5850526697248
Log2 TE fold difference:-0.37967764871245
Sequences
Protein sequence

MMMNRDILFHQQQQQQMEENMSNLTSASGDQASVSSGNRTETSGSNINQHHQEQCFVPQS
SLKRKRNQPGNPDPEAEVMALSPKTLMATNRFICEVCNKGFQRDQNLQLHKRGHNLPWKL
KQRSNKDVVRKKVYVCPEPGCVHHHPSRALGDLTGIKKHFFRKHGEKKWKCEKCSKKYAV
QSDWKAHAKTCGTKEYKCDCGTLFSRRDSFITHRAFCDALAEESARAMPNPIMIQASNSP
HHHHHQTQQNIGFSSSSQNIISNSNLHGPMKQEESQHHYQNIPPWLISSNPNPNGNNGNL
FPPVASSVNTGRSSFPHPSPAMSATALLQKAAQMGSTKSTTPEEEERSSRSSYNNLITTT
MAAMMTSPPEPGFGFQDYYMMNHQHHGGGEAFNGGFVPGEEKNDVVDDGGGETRDFLGLR
SLMSHNEILSFANNLGNCLNTSATEQQQQQHSHQD

MLLHQHQQPQQDENMSNLTSASGDQASVSSGNITEASGSNYFPHHQQQQEQQQQQIQKLS
CSWTDSLFQLFDTVTFLEILYPESEVIALSPKTLMATNRFVCEICNKGFQRDQNLQLHRR
GHNLPWKLKQRSNKEVIRKKVYVCPEASCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCD
KCSKKYAVQSDCKAHSKTCGTKEYRCDCGTLFSRRDSFITHRAFCEALAEETAREVVIPQ
NQNNNQPNPLLIHQSASHPHHHHQTQPTINVSSSSSSSHNHNIINSLHFDTNNGNTNNSN
NSNNHLHTFPMKKEQQSNDHIMNYHHSIIPPWLAPQPHALTSSNPNPSNGGGGGGSLFSL
ASPAMSATALLQKAAQMGSTKTPPLPPTTAYERSTHNNNLTTTMAAMMTSPSGFISSNNN
NHVLFQDYNASGFDNHGREEAFDDTFGGFLRTNEVTAAAGSEKSTKSGGGEGLTRDFLGL
RPLMSHNEILSFAGLGSCINSSASDQLHPKPWQG

Other information
Ka divergence:-0.0168741KaKs divergence:0.0579194
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1368Length 2 (bp):1545Length divergence:0.061
MFE 1 (kcal):-358.24MFE 2 (kcal):-392.25MFE divergence0.045