Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55120-AT3G13790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):beta-fructofuranosidase 5
Function (paralog2):Glycosyl hydrolases family 32 protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:5.3442973861241
Log2 mRNA fold difference:5.5825586835149
Log2 TE fold difference:-0.28937575514732
Sequences
Protein sequence

MAKLNRSNIGLSLLLSMFLANFITDLEASSHQDLNQPYRTGYHFQPLKNWMNDPNGPMIY
KGIYHLFYQYNPYGAVWDVRIVWGHSTSVDLVNWISQPPAFNPSQPSDINGCWSGSVTIL
PNGKPVILYTGIDQNKGQVQNVAVPVNISDPYLREWSKPPQNPLMTTNAVNGINPDRFRD
PTTAWLGRDGEWRVIVGSSTDDRRGLAILYKSRDFFNWTQSMKPLHYEDLTGMWECPDFF
PVSITGSDGVETSSVGENGIKHVLKVSLIETLHDYYTIGSYDREKDVYVPDLGFVQNESA
PRLDYGKYYASKTFYDDVKKRRILWGWVNESSPAKDDIEKGWSGLQSFPRKIWLDESGKE
LLQWPIEEIETLRGQQVNWQKKVLKAGSTLQVHGVTAAQADVEVSFKVKELEKADVIEPS
WTDPQKICSQGDLSVMSGLGPFGLMVLASNDMEEYTSVYFRIFKSNDDTNKKTKYVVLMC
SDQSRSSLNDENDKSTFGAFVAIDPSHQTISLRTLIDHSIVESYGGGGRTCITSRVYPKL
AIGENANLFVFNKGTQSVDILTLSAWSLKSAQINGDLMSPFIEREESRSPNHQF

MTKEVCSNIGLWLLLTLLIGNYVVNLEASHHVYKRLTQSTNTKSPSVNQPYRTGFHFQPP
KNWMNDPNGPMIYKGIYHLFYQWNPKGAVWGNIVWAHSTSTDLINWDPHPPAIFPSAPFD
INGCWSGSATILPNGKPVILYTGIDPKNQQVQNIAEPKNLSDPYLREWKKSPLNPLMAPD
AVNGINASSFRDPTTAWLGQDKKWRVIIGSKIHRRGLAITYTSKDFLKWEKSPEPLHYDD
GSGMWECPDFFPVTRFGSNGVETSSFGEPNEILKHVLKISLDDTKHDYYTIGTYDRVKDK
FVPDNGFKMDGTAPRYDYGKYYASKTFFDSAKNRRILWGWTNESSSVEDDVEKGWSGIQT
IPRKIWLDRSGKQLIQWPVREVERLRTKQVKNLRNKVLKSGSRLEVYGVTAAQADVEVLF
KVRDLEKADVIEPSWTDPQLICSKMNVSVKSGLGPFGLMVLASKNLEEYTSVYFRIFKAR
QNSNKYVVLMCSDQSRSSLKEDNDKTTYGAFVDINPHQPLSLRALIDHSVVESFGGKGRA
CITSRVYPKLAIGKSSHLFAFNYGYQSVDVLNLNAWSMNSAQIS

www.000webhost.com

Other information
Ka divergence:-0.139019KaKs divergence:-0.159412
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1785Length 2 (bp):1755Length divergence:-0.008
MFE 1 (kcal):-537.09MFE 2 (kcal):-513.6MFE divergence-0.022