Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55130-AT3G13772
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Endomembrane protein 70 protein family
Function (paralog2):transmembrane nine 7

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6970190984793
Log2 mRNA fold difference:1.7486187535078
Log2 TE fold difference:-0.12862059678951
Sequences
Protein sequence

MAIRIRISGTLLLSFLFFSTLHAFYLPGVAPRDFQKGDPLYVKVNKLSSTKTQLPYDFYY
LNYCKPPKILNTGENLGEVLRGDRIENSVYTFEMLEDQPCRVGCRVRVDAESAKNFREKI
DYEYRANMILDNLPVAVLRQRKDGIQSTTYEHGYRVGFKGSYEGSKEKKYFIHNHLSFRV
MYHRDQESESSRIVGFEVTPNSVLHEYKEWDENNPQLTTCNKDTKNLIQSNTVPQEVEEG
KEIVFTYDVAFKESVIKWASRWDTYLLMNDDQIHWFSIINSLMIVLFLSGMVAMIMMRTL
YKDISNYNQLETQDEAQEETGWKLVHGDVFRTPMNSGLLCVYVGTGVQIFGMTLVTMIFA
LLGFLSPSNRGGLTTAMVLLWVFMGIFAGYSSSRLHKMFKGNEWKRITLKTAFMFPGILF
AIFFVLNTLIWGERSSGAIPFSTMFALVCLWFGISVPLVFIGSYLGHKKPAIEDPVKTNK
IPRQVPEQPWYMKPGFSILIGGILPFGAVFIELFFILTSIWLNQFYYIFGFLFIVFLILI
VTCAEITIVLCYFQLCSEDYNWCWRAYLTSGSSSLYLFLYSVFYFFTKLEISKLVSGVLY
FGYMIIISYSFFVLTGSIGFYACLWFVRKIYSSVKID

MKKTKGSSFRFYATLLLSFLSFSLSRAFYLPGVAPRDFQKGDPLYVKVNKLSSTKTQLPY
DYYYLNYCKPPKILNNAENLGEVLRGDRIENSVYTFQMLEDQPCKVGCRVKLNADSTKNF
KEKIDDEYRANMILDNLPVAVLRQRRDGSQSTTYEHGFRVGFKGSYEGSKEEKYFIHNHL
SFRVMYHRDQESDSARIVGFEVTPNSILHEYKEWDEKNPQLTTCNKDTKNLIQGNTVPQE
VEQGKEIVFTYDVSFKESEIKWASRWDTYLLMNDDQIHWFSIINSLMIVLFLSGMVAMIM
MRTLYKDISNYNQLETQDEAQEETGWKLVHGDVFRPPVNSGLLCVYVGTGVQIFGMSLVT
MMFALLGFLSPSNRGGLMTAMVLLWVFMGIFAGYSSSRLHKMFKGNKWKRMTLKTAFMFP
GILFAIFFVLNALIWGEQSSGAIPFGTMFALFCLWFGISVPLVFVGSYLGYKKPAIEDPV
KTNKIPRQVPEQPWYMKPVFSILIGGILPFGAVFIELFFILTSIWLNQFYYIFGFLFIVF
LILIVTCAEITVVLCYFQLCSEDYNWWWRAYLTAGSSAFYLFLYSIFYFFTKLEITKLVS
GMLYFGYMIIISYAFFVLTGTIGFYACFWFVRKIYSSVKID

Other information
Ka divergence:-0.338536KaKs divergence:0.00730897
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1914Length 2 (bp):1926Length divergence:0.003
MFE 1 (kcal):-535.11MFE 2 (kcal):-551.25MFE divergence0.015