Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55140-AT3G13740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribonuclease III family protein
Function (paralog2):Ribonuclease III family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.046872379349864
Log2 mRNA fold difference:0.017801437986501
Log2 TE fold difference:0.096545387171195
Sequences
Protein sequence

MAILSASSTIVRAALDTQPKLRYNPNAPRNVKKNSNLSSFVPPSSPSSSSPATNLSVSVS
DLLKRPASKDIGDGFDDTCVGYEKWFPSPPKVEKPRSVFNAASLAYIGDSIYEIYARRHF
LFPPLSIEEYNDRVRAVVRCEAQYALLQKLVDDDFLTKDERDILRWGKNVGSVKTRSTRR
AGVAVYNKASSLETLIGYLYLSNGKRLEEMMQKLGFSSGSSTERMVKEAGSNKPSFK

MVILSASSTVRAALDTQPRLPYNPNAPRKVKKIPNGNSFLPPPSPAPSPGISISVADLLK
RPSSKEITVDVDDTYMGYETWSPSPPKLEKPRSVFNPASLAFIGDSIYELYARRHFLFPP
LSIEDYNDRVRAVVRCEAQYALLNKLVDDDFLTKEERDILRWGKNLGSARTRTRRRAGNA
VYNKASSLETLIGYLYLTNGKRLEKIMEKLGFSSDSSTEIVIEETNPKPSESSNLPNFIL
NEQVVSF

Other information
Ka divergence:0.00733272KaKs divergence:-0.099232
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):714Length 2 (bp):744Length divergence:0.021
MFE 1 (kcal):-194.51MFE 2 (kcal):-196.8MFE divergence0.006