Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55190-AT3G13720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PRA1 (Prenylated rab acceptor) family protein
Function (paralog2):PRA1 (Prenylated rab acceptor) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.9383581398311
Log2 mRNA fold difference:1.9526192404398
Log2 TE fold difference:-0.020999258725047
Sequences
Protein sequence

MTNYGAIPTSSHPSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISR
IKTNLGYFRANYAIGVLFILFLSLLYHPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQID
DRTVLIGLSVLTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAAVTEA
SGLMSYPSS

MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTR
IKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQID
DRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETS
GLTSYPST

www.000webhost.com

Other information
Ka divergence:-0.070076KaKs divergence:0.292111
GC content 1 (%):46GC content 2 (%):49GC content divergence:0.032
Length 1 (bp):570Length 2 (bp):567Length divergence:-0.003
MFE 1 (kcal):-158.4MFE 2 (kcal):-185.8MFE divergence0.08