Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55200-AT3G13690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with adenine nucleotide alpha hydrolases-like domain
Function (paralog2):Protein kinase protein with adenine nucleotide alpha hydrolases-like domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.16635658273596
Log2 mRNA fold difference:0.50788823073785
Log2 TE fold difference:-0.3785797741579
Sequences
Protein sequence

MSREKQGKRSGSNGTEKVLVAVKASREISKTAFVWALTHIVHPGDCITLIVVVTSYNAGR
KLWTFPRFAGDCATGHWKLHSDPMSEIKSDLTDTCSQMILQLHDVYDPNKVNVRIKIVSG
SPCGAVAAEAKKSQANWVVLDKHLKHEEKRCIDELQCNIVAMKRSEAKVLRLNLVGSSTK
EPELASEKNKNRLLDSVKAVVTTTPMSSPEVETSFTGTEAWTSSVSSSDLGTSSPVFTAE
VRKDETLVVKENESDSDSESENLSLPSLSKRFQPWISEYLSTHCVSMQESTRGDDKAVQV
STKKALLEKISKLDEGEEAAMSSKRKDLEEYSGTLRALSRNAPPVSPPLCSICQHKAPVF
GKPPRFFSYKELELATNGFSRANFLAEGGFGSVHRGVLPEGQIVAVKQHKVASTQGDVEF
CSEVEVLSCAQHRNVVMLIGFCIEDTRRLLVYEYICNGSLDSHLYGRHKDTLGWPARQKI
AVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDYEPLVGDFGLARWQPDGELGVDTRV
IGTFGYLAPEYAQSGQITEKADVYSFGVVLIELITGRKAMDIYRPKGQQCLTEWARSLLE
EYAVEELVDPRLEKRYSETQVICMIHTASLCIRRDPHLRPRMSQVLRLLEGDMLMNEISG
RFNGRLSTEKGLRDHN

MSRLQKRGKQEKPVVSDGAQKVIVAVKASREIPKTALIWALTHVVQPGDCITLIVVVPSH
NSGRKLWGFTKSFPMFAGDCASGHRKSHSEALPEIKSDLTDTCSQMILQLHDVYDPNKIN
VKIKIVSGSPCGAVAAESKKAQANWVVMDKHLKQEEKRCMDELQCNIVVMKRSQAKVLRL
NLVGSPKKDAGKECPLPSGPEAASEKHSKNTKGLLDADRGLPVTPTSSPELGTPFTSTEA
GTSSVSSSDLGTSPFFTLGMNGYMKKDGALVIKENDGLDDSGSETESENQSLASTSMRFQ
PWISEYIGTHRHSSQEAEESLLWKNDDRAQISTTKALLEKFSKLDVEVGLSSSRRMDLEF
SGNVRDAISLSRSAPPGPPPLCSICQHKAPVFGKPPRLFTYAELELATGGFSQANFLAEG
GYGSVHRGVLPEGQVVAVKQHKLASSQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEDSRR
LLVYEYICNGSLDSHLYGRQKETLEWPARQKIAVGAARGLRYLHEECRVGCIVHRDMRPN
NILITHDNEPLVGDFGLARWQPDGEMGVDTRVIGTFGYLAPEYAQSGQITEKADVYSFGV
VLVELVTGRKAIDITRPKGQQCLTEWARPLLEEYAIDELIDPRLGNRFVESEVICMLHAA
SLCIRRDPHLRPRMSQVLRILEGDMIMDGNYASTPGSEAGNRSGRFWADHYSGQLTNDGS
DRFSERLSVETPRLALRERERSQRFELNHNKQY

www.000webhost.com

Other information
Ka divergence:-0.276574KaKs divergence:-0.187817
GC content 1 (%):42GC content 2 (%):46GC content divergence:0.045
Length 1 (bp):2031Length 2 (bp):2262Length divergence:0.054
MFE 1 (kcal):-604.56MFE 2 (kcal):-733.29MFE divergence0.096