Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55205-AT3G13674
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.292741014083
Log2 mRNA fold difference:1.0941282590838
Log2 TE fold difference:1.3025278959705
Sequences
Protein sequence

MASSSKICRLSSKIHSLTQKLSKTNVHISSLPSPIKSSSPSSATSRINQSFRLPVELSCC
LSMLPLHSAIASARLISSLSVESKSWGLVPQGQSFSSLWLYYL

MASSRVLGRFSSRLKSLCQNLSNKNANVSSLPSPIKSASPSSATSCRLNRSSRLPVELSS
MIPLHSAIASSRLVSSLSVESKIWGLVPQGLSLPL

Other information
Ka divergence:0.0686058KaKs divergence:0.0230665
GC content 1 (%):40GC content 2 (%):44GC content divergence:0.048
Length 1 (bp):312Length 2 (bp):288Length divergence:-0.04
MFE 1 (kcal):-62.72MFE 2 (kcal):-54.57MFE divergence-0.069