Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55210-AT3G13662
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Disease resistance-responsive (dirigent-like protein) family protein
Function (paralog2):Disease resistance-responsive (dirigent-like protein) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-5.50022932606
Log2 mRNA fold difference:-2.8514521224926
Log2 TE fold difference:-2.5695708018979
Sequences
Protein sequence

MAKLIFFLAVQILFLAVVSSAGDGEDFARTMDRKLLGLHKKEKLTHFKVYWHDILSGPNP
TSIMIQPPVTNSSYFGAISMIDNALTAKVPMNSTVLGQAQGFYAGAAQKELGFLMAMNFA
FKTGKYNGSTITILGRNTALSEVREMPIVGGSGLFRFARGYVEARTKWINLKNGDATVEY
SCYVLHY

MTNLILIFAAQILLFYAVASVGDELGRTMNGKHLGPYKKEKLTHLRVYWHNSVNGRNPSS
VMIQQPVLNSSLSGSITMMDDPLTFDVPRNATVVGQAQGMYVAAAQGEIGFLMVMNFAFT
TGKYNGSTITILGRNVVMSKVREMPVVGGSGIFRFARGYVEARTKSFDLKAGC

www.000webhost.com

Other information
Ka divergence:0.398281KaKs divergence:0.331699
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):564Length 2 (bp):522Length divergence:-0.039
MFE 1 (kcal):-181.79MFE 2 (kcal):-165MFE divergence-0.048