Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55290-AT3G13610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein
Function (paralog2):2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.8180158570239
Log2 mRNA fold difference:4.9690649509038
Log2 TE fold difference:-2.1750045691704
Sequences
Protein sequence

MNQTLAAQFLTRDQVTNFVVHEGNGVKGLSETGIKVLPDQYIQPFEERLINFHVKEDSDE
SIPVIDISNLDEKSVSKAVCDAAEEWGFFQVINHGVSMEVLENMKTATHRFFGLPVEEKR
KFSREKSLSTNVRFGTSFSPHAEKALEWKDYLSLFFVSEAEASQLWPDSCRSETLEYMNE
TKPLVKKLLRFLGENLNVKELDKTKESFFMGSTRINLNYYPICPNPELTVGVGRHSDVSS
LTILLQDEIGGLHVRSLTTGRWVHVPPISGSLVINIGDAMQIMSNGRYKSVEHRVLANGS
YNRISVPIFVSPKPESVIGPLLEVIENGEKPVYKDILYTDYVKHFFRKAHDGKKTIDFAN
I

MAPTLLTTQFSNPAEVTDFVVYKGNGVKGLSETGIKALPEQYIQPLEERLINKFVNETDE
AIPVIDMSNPDEDRVAEAVCDAAEKWGFFQVINHGVPLEVLDDVKAATHKFFNLPVEEKR
KFTKENSLSTTVRFGTSFSPLAEQALEWKDYLSLFFVSEAEAEQFWPDICRNETLEYINK
SKKMVRRLLEYLGKNLNVKELDETKESLFMGSIRVNLNYYPICPNPDLTVGVGRHSDVSS
LTILLQDQIGGLHVRSLASGNWVHVPPVAGSFVINIGDAMQIMSNGLYKSVEHRVLANGY
NNRISVPIFVNPKPESVIGPLPEVIANGEEPIYRDVLYSDYVKYFFRKAHDGKKTVDYAK
I

Other information
Ka divergence:-0.175933KaKs divergence:-0.422162
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1086Length 2 (bp):1086Length divergence:0
MFE 1 (kcal):-310.06MFE 2 (kcal):-336.1MFE divergence0.04