Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55310-AT3G13570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SC35-like splicing factor 33
Function (paralog2):SC35-like splicing factor 30A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.69116263462662
Log2 mRNA fold difference:-0.68702871731489
Log2 TE fold difference:1.3118926445495
Sequences
Protein sequence

MRGRSYTPSPPRGYGRRGRSPSPRGRYGGRSRDLPTSLLVRNLRHDCRQEDLRKSFEQFG
PVKDIYLPRDYYTGSHLCTDTCKASRDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELT
VVFAEENRKKPTEMRARERGGGSRFRDRRRTPPRYYSRSRSPPPRRGRSRSRSGDYYSPP
PRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRR
SRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTPEPARSRSQSPHGGQYDEDRSPSQ

MRGRSYTPSPPRGYGRRGRSPSPRGRFGGSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQF
GPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFAEENRKKP
TEMRTRDRGGRSNRFQDRRRSPPRYSRSPPPRRGRRSRSRSRGYNSPPAKRHQSRSVSPQ
DRRYEKERSYSRSPPHNGSRVRSGSPGRVKSHSRSPRRSVSPRKNRSYTPEQARSQSPVP
RQSRSPTPVPRGAQNGDRSPSQ

Other information
Ka divergence:0.129924KaKs divergence:0.233288
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):903Length 2 (bp):789Length divergence:-0.067
MFE 1 (kcal):-311.83MFE 2 (kcal):-281.31MFE divergence-0.051