Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55360-AT3G13510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of Unknown Function (DUF239)
Function (paralog2):Protein of Unknown Function (DUF239)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.0723656913175
Log2 mRNA fold difference:-1.4309357817656
Log2 TE fold difference:-0.64350092670436
Sequences
Protein sequence

MGGVVHLSTAKLARGFLVCLCLWGFFSLSYAARSGVSKQKFEVKKHLNRLNKPAVKSIQS
SDGDVIDCVPISKQPAFDHPFLKDHKIQMKPNYHPEGLFDDNKVSAPKSNEKEGHIPQLW
HRYGKCSEGTIPMRRTKEDDVLRASSVKRYGKKKRRSVPLPKSAEPDLINQSGHQHAIAY
VEGDKYYGAKATINVWEPKIQQQNEFSLSQIWLLGGSFGQDLNSIEAGWQVSPDLYGDNN
TRLFTYWTSDAYQATGCYNLLCSGFIQINSDIAMGASISPVSGYRNSQYDISILIWKDPK
EGHWWMQFGNGYVLGYWPSFLFSYLTESASMIEWGGEVVNSQSDGQHTSTQMGSGKFPEE
GFSKASYFRNIQVVDGSNNLKAPKGLGTFTEQSNCYDVQTGSNDDWGHYFYYGGPGKNQK
CP

MGAEHFSLVKFNRGFFVCLWVMLSLSCAAASYGSSRQKFEVKKHLNRLNKPPVKTIQSPD
GDIIDCIPISKQPAFDHPFLKDHKIQMRPSYHPEGLFDDNKVSAEPKGKETHIPQLWHRY
GKCTEGTIPMRRTREDDVLRASSVKRYGKKKHRSVPIPKSAEPDLINQNGHQHAIAYVEG
DKYYGAKATLNVWEPKIQNTNEFSLSQIWLLGGSFGQDLNSIEAGWQVSPDLYGDNNTRL
FTYWTSDAYQATGCYNLLCSGFIQINSDIAMGASISPVSGYRNSQYDISILIWKDPKEGH
WWMQFGNGYVLGYWPSFLFSYLTESASMIEWGGEVVNSQSEGHHTWTQMGSGHFPEEGFS
KASYFRNIQVVDGSNNLKAPKGLGTFTEKSNCYDVQTGSNDDWGHYFYYGGPGKNKNCP

www.000webhost.com

Other information
Ka divergence:-0.0522388KaKs divergence:0.150844
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1269Length 2 (bp):1260Length divergence:-0.004
MFE 1 (kcal):-383.38MFE 2 (kcal):-381.31MFE divergence-0.003