Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55475-AT3G13480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.2925649896695
Log2 mRNA fold difference:-0.25357224611804
Log2 TE fold difference:1.105637337684
Sequences
Protein sequence

MINCLKDSIHVLMSVLLSTSDDDDDHEEILEHVDGLTNAEDREEVDAKEEEGQIVGDTLT
LKSSLRKVDSNSTEAEKREKKKVQWVDVIGKELAEIREFEPSDEDDIDSDRGKTCVCIIL

MIGCFKDPTYVLMRVLLCKIQCPSFICFCKPSPHIYASGSLKLENTFPQVSSSTTVVDDR
DHDDNDDDDAHVEEEEVVVDHVDGLLTEVVREEDCALEGKKEEEESLSNGEILKSSLKKE
VLDSADGGRKEKKKVQWVDLMGKELAEIREFESSEEEDVRYDGDQSCVCVIL

Other information
Ka divergence:-0.144851KaKs divergence:-0.232407
GC content 1 (%):39GC content 2 (%):40GC content divergence:0.013
Length 1 (bp):363Length 2 (bp):519Length divergence:0.177
MFE 1 (kcal):-76.76MFE 2 (kcal):-142.35MFE divergence0.299