Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55490-AT3G13470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):chaperonin 60 beta
Function (paralog2):TCP-1/cpn60 chaperonin family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.754919645737
Log2 mRNA fold difference:-2.205684086782
Log2 TE fold difference:0.3860292758644
Sequences
Protein sequence

MASTFTATSSIGSMVAPNGHKSDKKLISKLSSSSFGRRQSVCPRPRRSSSAIVCAAKELH
FNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDP
VENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAK
ALVTELKKMSKEVEDSELADVAAVSAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENN
LYVVEGMQFDRGYISPYFVTDSEKMSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYP
ILIIAEDIEQEALATLVVNKLRGTLKIAALRAPGFGERKSQYLDDIAILTGATVIREEVG
LSLDKAGKEVLGNASKVVLTKETSTIVGDGSTQDAVKKRVTQIKNLIEQAEQDYEKEKLN
ERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKV
DAIKATLDNDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSNDNVKFGYNAATG
KYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY

MASTFTATSSLGSLLAPNAIKLSSATSISSSSFGRRHNVCVRRSRPAIVCAAKELHFNKD
GTTIRKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENI
GAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAKALVN
ELKLMSKEVEDSELADVAAVSAGNNHEVGSMIAEAMSKVGRKGVVTLEEGKSAENNLYVV
EGMQFDRGYISPYFVTDSEKMSVEYDNCKLLLVDKKVTNARDLVGVLEDAIRGGYPILII
AEDIEQEALATLVVNKLRGTLKIAALKAPGFGERKSQYLDDIAILTGATVIREEVGLSLD
KAGKEVLGNASKVVLTKEMTTIVGDGTTQEAVNKRVVQIRNLIEQAEQDYEKEKLNERIA
KLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIK
DTLENDEEKVGAEIVKRALSYPLKLIAKNAGVNGSVVSEKVLANDNVKFGYNAATGKYED
LMAAGIIDPTKVVRCCLEHAASVAKTFLMSDCVVVEIPEPEPVPAGNPMDNSGYGY

Other information
Ka divergence:-0.0788066KaKs divergence:0.174444
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1803Length 2 (bp):1791Length divergence:-0.003
MFE 1 (kcal):-558.5MFE 2 (kcal):-582.23MFE divergence0.021