Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55500-AT3G13460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):evolutionarily conserved C-terminal region 4
Function (paralog2):evolutionarily conserved C-terminal region 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.1007173865601
Log2 mRNA fold difference:2.9565524994227
Log2 TE fold difference:0.17606656693947
Sequences
Protein sequence

MSTVAPPADQAADVLKKLSLDSKSRTLEIPEPTKKTGVYQYGAMDSNGQVPSFDRSLSPM
LPSDALDPSVFYVPNVYQQPYYYGYGSDYTGYTNSESVDMTSGAYGENASLVYPQGYGYA
AFPYSPATSPAPQLGGDGQLYGAQQYQYPFPLTASSGPFASSVPASTQSKLSTNKAANSA
SAGIPKGMNGSAPVKPLNQSALYGNSALGGGLAAGYQDPRYSYDGFYTPVSWHDGSNFSD
VQRSVSGSGVASSYSKANNNVPATRNQNSSSNSHYTSMYQPASMTGYAAQGYYDRVSPNK
SYGQYGSTVRSGMGYGSSGYGSRTNERGWLNTDNKYRSRGRGNSYFYGNENIDGLNELNR
GPRAKGTKATEEVSSEEVKKQTFDESNTEETVTCVLPDREECNRDDFPVEYKDAKFFIIK
SYSEDDVHKSIKYNVWASTPNGNKKLDAAYQEAQQKSSGCPVFLFFSVNASGQFIGLAEM
KGPVDFNKNIEYWQQDKWTGSFPLKWHILKDVPNSLLKHITLEYNENKPVTNSRDTQEVK
LEQGLKVVKIFKEHNSKTCILDDFSFYEARQKTILEKKAKQQQSQKQAREENGLGRKNQ

MATVAPPADQATDLLQKLSLDSPAKASEIPEPNKKTAVYQYGGVDVHGQVPSYDRSLTPM
LPSDAADPSVCYVPNPYNPYQYYNVYGSGQEWTDYPAYTNPEGVDMNSGIYGENGTVVYP
QGYGYAAYPYSPATSPAPQLGGEGQLYGAQQYQYPNYFPNSGPYASSVATPTQPDLSANK
PAGVKTLPADSNNVASAAGITKGSNGSAPVKPTNQATLNTSSNLYGMGAPGGGLAAGYQD
PRYAYEGYYAPVPWHDGSKYSDVQRPVSGSGVASSYSKSSTVPSSRNQNYRSNSHYTSVH
QPSSVTGYGTAQGYYNRMYQNKLYGQYGSTGRSALGYGSSGYDSRTNGRGWAATDNKYRS
WGRGNSYYYGNENNVDGLNELNRGPRAKGTKNQKGNLDDSLEVKEQTGESNVTEVGEADN
TCVVPDREQYNKEDFPVDYANAMFFIIKSYSEDDVHKSIKYNVWASTPNGNKKLAAAYQE
AQQKAGGCPIFLFFSVNASGQFVGLAEMTGPVDFNTNVEYWQQDKWTGSFPLKWHIVKDV
PNSLLKHITLENNENKPVTNSRDTQEVKLEQGLKIVKIFKEHSSKTCILDDFSFYEVRQK
TILEKKAKQTQKQVSEEKVTDEKKESATAESASKESPAAVQTSSDVKVAENGSVAKPVTG
DVVANGC

Other information
Ka divergence:-0.121081KaKs divergence:0.383432
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1800Length 2 (bp):2004Length divergence:0.054
MFE 1 (kcal):-556.24MFE 2 (kcal):-642.87MFE divergence0.072