Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55510-AT3G13450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):branched-chain alpha-keto acid decarboxylase E1 beta subunit
Function (paralog2):Transketolase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.6572046405987
Log2 mRNA fold difference:0.64244005754003
Log2 TE fold difference:-0.0519056868063
Sequences
Protein sequence

MAALLGRSCRKLSFPSLSHGARRVSTETGKPLNLYSAINQALHIALDTDPRSYVFGEDVG
FGGVFRCTTGLAERFGKNRVFNTPLCEQGIVGFGIGLAAMGNRAIVEIQFADYIYPAFDQ
IVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVVIPRSPR
EAKGLLLSCIRDPNPVVFFEPKWLYRQAVEEVPEHDYMIPLSEAEVIREGNDITLVGWGA
QLTVMEQACLDAEKEGISCELIDLKTLLPWDKETVEASVKKTGRLLISHEAPVTGGFGAE
ISATILERCFLKLEAPVSRVCGLDTPFPLVFEPFYMPTKNKILDAIKSTVNY

MAAALVRRFCRGSSFPVSGHGYRMLSTVENVSESGKSMNLYSAINQALHIALETDPRSYV
FGEDVGFGGVFRCTTGLAERFGKSRVFNTPLCEQGIVGFGIGLAAMGNRVIAEIQFADYI
FPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGHYHSQSPEAFFCHVPGIKVV
IPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVEDVPEDDYMIPLSEAEVMREGSDIT
LVGWGAQLTIMEQACLDAENEGISCELIDLKTLIPWDKEIVETSVRKTGRLLISHEAPVT
GGFGAEIAATIVERCFLRLEAPVSRVCGLDTPFPLVFEPFYMPTKNKILDAIRSTVNY

www.000webhost.com

Other information
Ka divergence:0.285752KaKs divergence:-0.0160665
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1059Length 2 (bp):1077Length divergence:0.008
MFE 1 (kcal):-313.1MFE 2 (kcal):-320MFE divergence0.011