Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55520-AT3G13445
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TATA binding protein 2
Function (paralog2):TATA binding protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.25057900735834
Log2 mRNA fold difference:-0.18847988721748
Log2 TE fold difference:0.46845048994897
Sequences
Protein sequence

MADQGTEGSQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAV
IMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQKLGFPAKFKDFKIQNIVG
SCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLLIFVSGKIVITGAKMREE
TYTAFENIYPVLREFRKVQQ

MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAV
IMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVG
SCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDE
TYKAFENIYPVLSEFRKIQQ

Other information
Ka divergence:1KaKs divergence:-0.627628
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):603Length 2 (bp):603Length divergence:0
MFE 1 (kcal):-158.82MFE 2 (kcal):-175.43MFE divergence0.05