Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55610-AT3G13380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):BRI1 like
Function (paralog2):BRI1-like 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.2718160603634
Log2 mRNA fold difference:1.5037992720602
Log2 TE fold difference:0.11046598707876
Sequences
Protein sequence

MKQRWLLVLILCFFTTSLVMGIHGKHLINDDFNETALLLAFKQNSVKSDPNNVLGNWKYE
SGRGSCSWRGVSCSDDGRIVGLDLRNSGLTGTLNLVNLTALPNLQNLYLQGNYFSSGGDS
SGSDCYLQVLDLSSNSISDYSMVDYVFSKCSNLVSVNISNNKLVGKLGFAPSSLQSLTTV
DLSYNILSDKIPESFISDFPASLKYLDLTHNNLSGDFSDLSFGICGNLTFFSLSQNNLSG
DKFPITLPNCKFLETLNISRNNLAGKIPNGEYWGSFQNLKQLSLAHNRLSGEIPPELSLL
CKTLVILDLSGNTFSGELPSQFTACVWLQNLNLGNNYLSGDFLNTVVSKITGITYLYVAY
NNISGSVPISLTNCSNLRVLDLSSNGFTGNVPSGFCSLQSSPVLEKILIANNYLSGTVPM
ELGKCKSLKTIDLSFNELTGPIPKEIWMLPNLSDLVMWANNLTGTIPEGVCVKGGNLETL
ILNNNLLTGSIPESISRCTNMIWISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVP
RQLGNCKSLIWLDLNSNNLTGDLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGG
LVEFEGIRAERLERLPMVHSCPATRIYSGMTMYTFSANGSMIYFDISYNAVSGFIPPGYG
NMGYLQVLNLGHNRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSN
NNLTGPIPFGGQLTTFPVSRYANNSGLCGVPLRPCGSAPRRPITSRIHAKKQTVATAVIA
GIAFSFMCFVMLVMALYRVRKVQKKEQKREKYIESLPTSGSCSWKLSSVPEPLSINVATF
EKPLRKLTFAHLLEATNGFSAETMVGSGGFGEVYKAQLRDGSVVAIKKLIRITGQGDREF
MAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKWGSLETVLHEKSSKKGGIYLNWAA
RKKIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLS
VSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWAK
QLYREKRGAEILDPELVTDKSGDVELFHYLKIASQCLDDRPFKRPTMIQLMAMFKEMKAD
TEEDESLDEFSLKETPLVEESRDKEP

MKQQWQFLILCLLVLFLTVDSRGRRLLSDDVNDTALLTAFKQTSIKSDPTNFLGNWRYGS
GRDPCTWRGVSCSSDGRVIGLDLRNGGLTGTLNLNNLTALSNLRSLYLQGNNFSSGDSSS
SSGCSLEVLDLSSNSLTDSSIVDYVFSTCLNLVSVNFSHNKLAGKLKSSPSASNKRITTV
DLSNNRFSDEIPETFIADFPNSLKHLDLSGNNVTGDFSRLSFGLCENLTVFSLSQNSISG
DRFPVSLSNCKLLETLNLSRNSLIGKIPGDDYWGNFQNLRQLSLAHNLYSGEIPPELSLL
CRTLEVLDLSGNSLTGQLPQSFTSCGSLQSLNLGNNKLSGDFLSTVVSKLSRITNLYLPF
NNISGSVPISLTNCSNLRVLDLSSNEFTGEVPSGFCSLQSSSVLEKLLIANNYLSGTVPV
ELGKCKSLKTIDLSFNALTGLIPKEIWTLPKLSDLVMWANNLTGGIPESICVDGGNLETL
ILNNNLLTGSLPESISKCTNMLWISLSSNLLTGEIPVGIGKLEKLAILQLGNNSLTGNIP
SELGNCKNLIWLDLNSNNLTGNLPGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGG
LVEFEGIRAERLEHFPMVHSCPKTRIYSGMTMYMFSSNGSMIYLDLSYNAVSGSIPLGYG
AMGYLQVLNLGHNLLTGTIPDSFGGLKAIGVLDLSHNDLQGFLPGSLGGLSFLSDLDVSN
NNLTGPIPFGGQLTTFPLTRYANNSGLCGVPLPPCSSGSRPTRSHAHPKKQSIATGMSAG
IVFSFMCIVMLIMALYRARKVQKKEKQREKYIESLPTSGSSSWKLSSVHEPLSINVATFE
KPLRKLTFAHLLEATNGFSADSMIGSGGFGDVYKAKLADGSVVAIKKLIQVTGQGDREFM
AEMETIGKIKHRNLVPLLGYCKIGEERLLVYEYMKYGSLETVLHEKTKKGGIFLDWSARK
KIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVS
TLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPEEFGEDNNLVGWAKQL
YREKRGAEILDPELVTDKSGDVELLHYLKIASQCLDDRPFKRPTMIQVMTMFKELVQVDT
ENDSLDEFLLKETPLVEESRDKEP

Other information
Ka divergence:-0.0961358KaKs divergence:-0.0137672
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):3501Length 2 (bp):3495Length divergence:-0.001
MFE 1 (kcal):-1132.74MFE 2 (kcal):-1115.99MFE divergence-0.007