Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55680-AT3G13340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0207555636634
Log2 mRNA fold difference:-0.89821782646832
Log2 TE fold difference:-0.083473088219931
Sequences
Protein sequence

MSNYQGDDAEYMEDVDDEMDEDDLDEDFRGDDMAASDSDVDEFDYSNNKIADTSADQARK
GKDIQGIPWDRLSITRETYRQTRLEQYKNYENVPNSGESSGKDCMATQKGALFYDFWRNT
RSIKSSILHFQLRNLVWATSKHDVYLMSQYLVSHYSTLTSGKHDVLNVQGHVSPSEKHPG
SLLEGFTKTQVSTLAVRDKFLVAGGFQGELICKHLDRPGVSFCSRTTYDDNAITNAIEIY
NKPSGALHFTASNNDCGVRDFDMERYQLVNQFRFPWPVNHTSLSPDGKLLTIVGDNPESL
LVDPNTGKTLATLSGHLDFSFASAWHPDGFTFSTGNQDKTCRVWDIRNLSKSVAVLRGNL
GAIRSIRYTSDGKYMAMAEPADFVHVYDVSNGYETEQEIDFFGEISGISFSPDTEALFIG
VWDRTYGSLIEYSRRHNYSYLDSFL

MSNYRGDDAEYMEDVDDEMEDVEDDMDEEFRGDDLGASDSDVEEFDYSNNKVADTTAEQA
RKGKDIQGIPWDRLNISREKYRQTRLEQYKNYENVPNSGESSEKVCKVTQKGGLFYDFWR
NSRSIKSTILHFQLRNLVWATSKHDVYLMSNFLVTHYSSLTSGKHEVLNVRGHVAPSEKH
PGSLLEGFTQTQVSTLAVKDDFLVAGGFQGELICKHLDRPGVSFCSRMTYDDNAITNAIE
IYNKPSGALHFTASNNDCGVRDFDMERYQLVKHFRFPWPVNHASLSPDGKLLAIVGDNPE
GLIVDPNTGKTLETLSGHLDFSFASAWHPDGVTFSTGNQDKTCRVWDIRNLSQSVTVLKG
NLGAIRSIRYTSDGKYMAMAEPADFVHVYDVSNGYETEQEIDFFGEISGISFSPDTEALF
IGVWDRTYGSLLEFGRRRNYSYLDSYL

www.000webhost.com

Other information
Ka divergence:-0.137629KaKs divergence:-0.150992
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1338Length 2 (bp):1344Length divergence:0.002
MFE 1 (kcal):-399.96MFE 2 (kcal):-396.88MFE divergence-0.004