Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55720-AT1G55730
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cation exchanger 6
Function (paralog2):cation exchanger 5

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.3875031688319
Log2 mRNA fold difference:4.5334080411647
Log2 TE fold difference:-2.1495745436357
Sequences
Protein sequence

MYMELYLMFSNFFKSIRWCKVPAFMQAKVEMGLVNEVELKSLLEQETDSPQTNAASLMEQ
GSLRERRAKAPRNSVVQSFKIVILSNKLNLLLPFGPLAILVHYLTDNKGWFFLLSLVGIT
PLAERLGYATEQLSCYTGATVGGLLNATFGNVIELIISIIALKNGMIRVVQLTLLGSILS
NILLVLGCAFFCGGLVFPGKDQVFDKRNAVVSSGMLLMAVMGLLFPTFLHYTHSEVHAGS
SELALSRFISCIMLVAYAAYLFFQLKSQPSFYTEKTNQNEETSNDDEDPEISKWEAIIWL
SIFTAWVSLLSGYLVDAIEGTSVSWKIPISFISVILLPIVGNAAEHAGAIMFAMKDKLDL
SLGVAIGSSIQISMFAVPFCVVIGWMMGAQMDLNLQLFETATLLITVIVVAFFLQLEGTS
NYFKRLMLILCYLIVAASFFVHEDPHQGTDHQQICTCRTPSYTYEIL

MGCCKVPALIQAQVEMGLVNDVEHKSLFRRDTDSPERKAASLMEQGSLSASFRECSTKTP
NNSVLQSFKIVILSNKLNLLLPFGPLAILLHYLTDNKGWIFLLSLVGITPLAERLGYATE
QLACYTGSTVGGLLNATFGNVTELIISIFALKSGMIRVVQLTLLGSILSNMLLVLGCAFF
CGGLVFSQKEQVFDKGNAVVNSGLLLMAVMGLLFPAVLHYTHSEVHAGSSELALSRFSSC
IMLVAYAAYLFFQLKSQPSSYTPLTEETNQNEETSDDDEDPEISKWEAIIWLSILTAWVS
LLSGYLVDAIEGASVSWKIPISFISVILLPIVGNAAEHAGAIMFAMKDKLDLSLGVAIGS
SIQISMFAVPFCVVIGWMMGAQMDLNFQLFETATLFITVIVVAFFLQEGTSNYFKGLMLI
LCYLIVAASFFVHEDPHQDDI

www.000webhost.com

Other information
Ka divergence:-0.785787KaKs divergence:0.120257
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1404Length 2 (bp):1326Length divergence:-0.029
MFE 1 (kcal):-416.54MFE 2 (kcal):-395.35MFE divergence-0.026