Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55720-AT3G13320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cation exchanger 6
Function (paralog2):cation exchanger 2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.0684702741356
Log2 mRNA fold difference:5.1345957574019
Log2 TE fold difference:-2.0763384703205
Sequences
Protein sequence

MYMELYLMFSNFFKSIRWCKVPAFMQAKVEMGLVNEVELKSLLEQETDSPQTNAASLMEQ
GSLRERRAKAPRNSVVQSFKIVILSNKLNLLLPFGPLAILVHYLTDNKGWFFLLSLVGIT
PLAERLGYATEQLSCYTGATVGGLLNATFGNVIELIISIIALKNGMIRVVQLTLLGSILS
NILLVLGCAFFCGGLVFPGKDQVFDKRNAVVSSGMLLMAVMGLLFPTFLHYTHSEVHAGS
SELALSRFISCIMLVAYAAYLFFQLKSQPSFYTEKTNQNEETSNDDEDPEISKWEAIIWL
SIFTAWVSLLSGYLVDAIEGTSVSWKIPISFISVILLPIVGNAAEHAGAIMFAMKDKLDL
SLGVAIGSSIQISMFAVPFCVVIGWMMGAQMDLNLQLFETATLLITVIVVAFFLQLEGTS
NYFKRLMLILCYLIVAASFFVHEDPHQGTDHQQICTCRTPSYTYEIL

MSCCKVPVLIEAQVEMVSANELENKSLFRQEEDATQTKEASLMEQGSLSTSFPQHTPKAP
KNSVLNSIKIVIFCNKLNLLLPFGPLAILVHYMIDSKGWVFLLTLVGITPLAERLGYATE
QLACYTGPTVGGLLNATFGNVTELIISIFALKNGMIRVVQLTLLGSILSNMLLVLGCAFF
CGGLVFYQKDQVFDKGIATVNSGLLLMAVMGILFPAVLHYTHSEVHAGSSELALSRFSSC
IMLIAYAAYLFFQLKSQSNSYSPLDEESNQNEETSAEDEDPEISKWEAIIWLSILTAWVS
LLSGYLVDAIEGASVSWNIPIAFISTILLPIVGNAAEHAGAIMFAMKDKLDLSLGVAIGS
SIQISMFAVPFCVVIGWMMGQQMDLNFQLFETAMLFITVIVVAFFLQEGSSNYFKGLMLI
LCYLIVAASFFVHEDPHQDGI

www.000webhost.com

Other information
Ka divergence:-0.224447KaKs divergence:0.1169
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1404Length 2 (bp):1326Length divergence:-0.029
MFE 1 (kcal):-416.54MFE 2 (kcal):-395.36MFE divergence-0.026