Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55820-AT3G13222
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Kinase-related protein of unknown function (DUF1296)
Function (paralog2):GBF-interacting protein 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.027019957610664
Log2 mRNA fold difference:0.62052399790301
Log2 TE fold difference:-0.5864714772361
Sequences
Protein sequence

MSSSDGGSSRVSIPYHLRKTLQKIREYTGKQHSDEDIFAVYKDSFNDPHETAQKLLFLDT
FHEVRSKREKKKEPIVPVTQPSGRGGRRNFASSNSYQGSGRNASFKRENGANHVTRGSRT
AQPATNKASNITVPNETKVSGPASIPSEVSNHKAQDDPSLISASRCSSKSDQAIEIETAS
KQGKNQSLPKPDVSEQSHVTFPFHLQVAKGLQNGLTFGSFDSNFVKEVSSSNGASGGYDS
NFESSHGTGDDERESSPTTNGITGVASAREETSTVSEDKDYGISNSATGAEPVVHSDHIV
PPVEEVPKEEALSNTETHQIAYGQEAPLSVFGLVPSLSAIGQPVNTEAAETQPGNSNSPP
ISLVSYPPDQSSIAAATQQTNFLRQQYPPNFFPYGYYSPYYMPPPYIHQFLSPNGIPQQS
YFPQGAALTAPSHAKPVDNTENPPTTNPYLHTSPMVASSIPSTTTLNSIHSEEKASHLTE
SAAAWIGQGFGNLQVNPMYNLAYQGQPLGFPVVQAGHGGLMGMHQPTQPMAAASTTYQTL
PPPPHTTTAMGEPIGHPHIAYQQPQAALTNWVNNY

MSRISGDGGSRVSIPADLLQTIQNIREVTGKQHSDEDIFSVFKECFSDPHETTQKLLYLD
TFHEVRSKRERKKENLVPNTQGRGRTGRKNFASSYTDASNGRSAAFKKQSGANHIIGGSG
TASSAPNNARNDTKPSSIMAPNPISLPSGISNQKIQDAIISPVDKVDTEEQPLSKATSSS
KDVVEPDKSKESSVSVAVSDSVVENDTQYAVVETFQIPQQSERVIKSEVAASKCKNESLL
KSDVGERPHVTFPVHIQVAKMLENGLTFGSFDSNFVREASSDKFTIGCDDSNIESSHGTA
ASARKDISTFSQDKNHEISNSAAQNELTLQPDQTVLPEEGSEGDKVKNEVLPITDTHQAA
KCDAPPISYPDQYSLAAAQQAMHLYRQQYSLNYFPYGPYFPPYYMPQPYIHQYLSPNGFQ
QQSYLPPGDDAPAPPGAELPLTHIKPGSDIGNSPPTTIPFSYTSYAFNHIPSAATINATH
KEEKKENMYTTGPLSLANLQASPMYNLSLQGQPIAFPTMQAGIRGLYQQTQPILAPLSIS
ARTEPIGPSHVTNQQPQAARTNLGNNY

www.000webhost.com

Other information
Ka divergence:-0.0722195KaKs divergence:-0.139783
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1728Length 2 (bp):1704Length divergence:-0.007
MFE 1 (kcal):-490.88MFE 2 (kcal):-481.69MFE divergence-0.009