Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55890-AT3G13160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0197738699804
Log2 mRNA fold difference:-0.11946305863371
Log2 TE fold difference:-1.0730881187718
Sequences
Protein sequence

MSSLSRVLRGTFNTCPIRRFSSAATVVSEPTAVTAAISPPQKSLTSLVNGERNPKRIVEK
FKKACESERFRTNIAVYDRTVRRLVAAKRLHYVEEILEEQKKYRDMSKEGFAARIISLYG
KAGMFENAQKVFEEMPNRDCKRSVLSFNALLSAYRLSKKFDVVEELFNELPGKLSIKPDI
VSYNTLIKALCEKDSLPEAVALLDEIENKGLKPDIVTFNTLLLSSYLKGQFELGEEIWAK
MVEKNVAIDIRTYNARLLGLANEAKSKELVNLFGELKASGLKPDVFSFNAMIRGSINEGK
MDEAEAWYKEIVKHGYRPDKATFALLLPAMCKAGDFESAIELFKETFSKRYLVGQTTLQQ
LVDELVKGSKREEAEEIVKIAKTNDFLKLKLNLPSQEE

MSSLSRFLLRGNFSFSTHTNRRFFSAVTAAAATPSPPKPSLITLVNDERDPKFITEKFKK
ACQAEWFRKNIAVYERTVRRLAAAKKFEWVEEILEEQNKYPNMSKEGFVARIINLYGRVG
MFENAQKVFDEMPERNCKRTALSFNALLNACVNSKKFDLVEGIFKELPGKLSIEPDVASY
NTLIKGLCGKGSFTEAVALIDEIENKGLKPDHITFNILLHESYTKGKFEEGEQIWARMVE
KNVKRDIRSYNARLLGLAMENKSEEMVSLFDKLKGNELKPDVFTFTAMIKGFVSEGKLDE
AITWYKEIEKNGCRPLKFVFNSLLPAICKAGDLESAYELCKEIFAKRLLVDEAVLQEVVD
ALVKGSKQDEAEEIVELAKTNDYLQCKLRLFPKE

Other information
Ka divergence:0.0586327KaKs divergence:-0.668696
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1197Length 2 (bp):1185Length divergence:-0.005
MFE 1 (kcal):-365.05MFE 2 (kcal):-352.84MFE divergence-0.017