Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55920-AT3G13110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):serine acetyltransferase 2;1
Function (paralog2):serine acetyltransferase 2;2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.65164502659379
Log2 mRNA fold difference:0.47288587631738
Log2 TE fold difference:0.084316045819718
Sequences
Protein sequence

MATCIDTCRTGNTQDDDSRFCCIKNFFRPGFSVNRKIHHTQIEDDDDVWIKMLEEAKSDV
KQEPILSNYYYASITSHRSLESALAHILSVKLSNLNLPSNTLFELFISVLEESPEIIEST
KQDLIAVKERDPACISYVHCFLGFKGFLACQAHRIAHTLWKQNRKIVALLIQNRVSESFA
VDIHPGAKIGKGILLDHATGVVIGETAVVGDNVSILHGVTLGGTGKQSGDRHPKIGDGVL
IGAGSCILGNITIGEGAKIGSGSVVVKDVPARTTAVGNPARLIGGKENPRKHDKIPCLTM
DQTSYLTEWSDYVI

MLPVTSRRHFTMSLYMLRSSSPHINHHSFLLPSFVSSKFKHHTLSPPPSPPPPPPMAACI
DTCRTGKPQISPRDSSKHHDDESGFRYMNYFRYPDRSSFNGTQTKTLHTRPLLEDLDRDA
EVDDVWAKIREEAKSDIAKEPIVSAYYHASIVSQRSLEAALANTLSVKLSNLNLPSNTLF
DLFSGVLQGNPDIVESVKLDLLAVKERDPACISYVHCFLHFKGFLACQAHRIAHELWTQD
RKILALLIQNRVSEAFAVDFHPGAKIGTGILLDHATAIVIGETAVVGNNVSILHNVTLGG
TGKQCGDRHPKIGDGVLIGAGTCILGNITIGEGAKIGAGSVVLKDVPPRTTAVGNPARLL
GGKDNPKTHDKIPGLTMDQTSHISEWSDYVI

www.000webhost.com

Other information
Ka divergence:0.102618KaKs divergence:0.0402219
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):945Length 2 (bp):1176Length divergence:0.109
MFE 1 (kcal):-281.69MFE 2 (kcal):-342.62MFE divergence0.098