Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55930-AT3G13070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBS domain-containing protein / transporter associated domain-containing protein
Function (paralog2):CBS domain-containing protein / transporter associated domain-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.94569748504382
Log2 mRNA fold difference:2.2296668454347
Log2 TE fold difference:-1.382006869695
Sequences
Protein sequence

MELDLSVLGRSFIVTRRNSSITRPCIQSSNFSVRVLQRNKHRPLCFSTNPSNSSFIRFQK
GCDFSHRCQFVVLSATGDHVGISQKHSDSTEKVDSIRILLKRGIVLGAVVCGVLFYGCGK
VLASTSVVDVAFSKSILLLKNAWPKTSQVLKVLREQGLILAVLLGLSAFFSMAETSITTL
WPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTKAATAIFGEAGV
SAATGVMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLILYPVGRVVTYLSMGIL
KILGLKGRSEPYVTEDELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDV
VAIDGSGSLVDFHNFWVTHQYSRVPVFEQRIDNIVGIAYAMDLLDYVPKGKLLESTTVVD
MAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDEN
DSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMAEGHQYETVSGFVCEAFGYI
PKTGESVTVVLEKENWEENDEQDEGKHERQDQKEKHQIYRLEILAGNARKVSAVRFERVS
DMDQVSEARDVKNMVPKFVRKWSSEEDSDGNLQAKNAVFDEHLIAETESMKKE

MMGMALELSVLGRSVIDSKTLNLKRYGQKSKLSGRFLPRAELHCPVALSSSKHSNLSFRF
RRSCEFSYRSRFMLFSSSQCHEGSQRKSDSGEKELESIKVLLKRGIVIGALVCGVFLYGC
QKVLASAGVVEAGYEVFGQSVVLFKNALPKIYQVLTVLREQGLILAALLSLSAFFSMAET
SITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIF
GEAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYL
SMGILKILGLKGRSEPYVTEDELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMT
PLVDVVAIDASASLVDFHSMWVTHQYSRVPVFEQRIDNIVGIAYAMDLLDYVQKGDLLES
TSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGE
IFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSGFVCE
AFGYIPKTGESVKVVLEKESWEEDGEEEEGKQERQEPKEKNQIYRVEILAGNARKVSAVR
FERVNDMDQVSEASDVKSMVPKFVRKWSSEEDDGNLSNEEDQSENAVLDEHVLADNSKKQ
Q

Other information
Ka divergence:0.0431955KaKs divergence:-0.0264484
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1962Length 2 (bp):1986Length divergence:0.006
MFE 1 (kcal):-581.69MFE 2 (kcal):-604.44MFE divergence0.019