Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55960-AT3G13062
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):Polyketide cyclase/dehydrase and lipid transport superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.11420187666103
Log2 mRNA fold difference:0.15137934331632
Log2 TE fold difference:-0.30581700205763
Sequences
Protein sequence

MKSVSTWALSFFSDELSRRAVSDCYLWTTAISLLLILLLHIFFSTKFRFFTSAPSSSSSS
SSSSSPSTESVPANSQSRISKLVSDEDLKFLIENLEEETNDSTEIWEHVIHKSNDRISYS
AKRCKPKDGGGPMKYLSVTVFEGFSAEIVRDFYMDNDYRKLWDKTVVEHEQLQVDSNTGI
EIGRTIKKFPLLTSREYVLAWRLWQGKEKKFYCFTKECDHNMVPQQRKYVRVSYFRSGWR
IRQVPGRNACEIKMFHQENAGLNVEMAKLAFSKGIWSYVCKMENALCKYIATSHRTQGPI
LSAVTLMKEVPSELETGTDNVTGSMETSSGEGVLSHVVAAKQKKKMRKPSTKLIAKGLVL
VGGAICLSRGPSALGAKVALAYLLTKLNKRGTSLNQTTQTTTI

MNSGDTLSTLAQFISSSERFFRRADGDVVFCYCWATVLALVFILLYQFFLSRKFRFFSHA
SSSSPVVSVSQSLSSQSGISTTLVSDEDLKGLIQKLGERSEDAEIWEDVIKKSNPRISYT
AKCCKPTDGSPMKYLSTTVFEDCSPEVLRDFYMDNEYRKQWDKTVVEHEQLQVDSNSGIE
IGRTIKKFPLLTPREYVLAWKLWEGKDKFYCFIKECDHNMVPQQRKYVRVSYFRSGWRIR
KVPGRNACEIHMVHQEDAGLNVEMAKLAFSRGIWSYVCKMENALRKYIATSHRPQGPTLS
AVSLMKKIPSELESQTDDITNSSGTTTSGMHTGEGAKRKKLLRKPSKKLIANGMLLVGGA
VGGAICLSRGHSALGAKVALAYFLSKMRKRGAQLSQTSQNAVGSGLGHSCGLSPNVSVSA
SFLAVHFSIHTSRFIRLFTQ

Other information
Ka divergence:0.0699679KaKs divergence:-0.118741
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1212Length 2 (bp):1323Length divergence:0.044
MFE 1 (kcal):-332.88MFE 2 (kcal):-413.03MFE divergence0.107