Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G55970-AT3G12980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):histone acetyltransferase of the CBP family 4
Function (paralog2):histone acetyltransferase of the CBP family 5

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.9959458382263
Log2 mRNA fold difference:1.473122488088
Log2 TE fold difference:0.59487585281605
Sequences
Protein sequence

MNNNKEVPQNSVAVSSSSSAPITVISPQQDANNFIKKRRTALRNRIYAIVRHKQKQHQIF
LDKKNQQQQQRVDDATQRALLEKQDQQCIAATRMIEEELLKSSRSFEEYFDLRTFDARVR
TILQQLGTMLSQRRAAAAAMNNGEAQCITSTRAVHTSISVSNSFQCGRSLVPINCTTATA
GAFSIGPDMQTHHSTGANHQMVEVNRPNMNQITCGISSPLITGFNGNCVPVSANIPMTSQ
DLFNATHFSTLPQPFLQPPPDQSHMHRYSMSNVASFGQSNPYPCGVVMSSGSMAVAQNSI
PWNNPNPMQGLDPTVTSYHSNLQPMQQTPLPKRQLHHPLWNTNFQSAPNNRDNLPQVSQQ
LSNHGSRQHRGQHSQNLYPGQLQNQDRLLPNLTQQAMALAAPVMHVPSKQVNEDCGQTSS
NTVLRWIPFMFHARHCKAKKDKCASKFCFQARKIVKHIDCCKVPNCKYRYCLGTRMWLDH
FKQCKSISCRTCVAVREYMEKNKYTIVPLRRAKCSSASSKCQPKKSSKSRQAYKKGGAEA
PSVDADLQRSIKRPKLHRPSQNITPETKSISVTGCGVVCKPHSLMNMQEKDGLQSLKVEA
MPMDIDVPGASEIPVTRELVKHVAEDTPKGNNCGGFAMVEKTSCLLAQGKSKCMNEMSAP
KEENVKQSVEVVDASKMEISSLVELFTPEQVKEHIRSLRQWVGQSKTKAEKNKAMGCSMS
VNSCQLCAVEWLVFEPVPIYCSPCGIRIKKNALHYSIAVGESRHYVCAPCYNEAREKLVF
LDGTSIPKTRLQKKKNDEQVPEGWVQCDKCEAWQHIICALFNSRRNHGESTKYTCPSCYI
QEVEQRERRPLPLSAVPGATSLPVTSLSKHLEERLFKKLKEERQERARLQGKTYEEVPGA
ESLTVRVVASVDKVLEVKERFLELFREENYPSEFPYKSKAIFLFQKIENVEVCLFGMFVQ
EFGTDSGPPNERRTFRTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPLKGDDY
ILYCHPEIQKTPKTDKLREWYLAMLRKASKEDVVVECTNLYNHFFVQSGECRANVTAARL
PYFDGDYWPSAAEDLLRQMNQEDDGETKLHRKGLTKKVISKRALKAVGQLDLSLNASKDR
LMMQKLGETICPMKEDFIMVHLQHCCKHCTTLMVSGNRWVCNHCKNFQICDKCYEVEQNR
INIERHPINQKEKHALFPVAIKDVPTKIEDKDNNLESEFFHNRQAFLNLCQGNNYQYETL
RRAKHSSMMILYHLHNPTAPAFATVCTICQQEVENSQGWHCEVCPGYDVCSACYSKDSIN
HSHKLTSRSSSTDSTVVQQNGQASQSYQVKLEKLKKLLVHAATCRSTQCQYQGCRKSKML
FRHCIDCTTGDCPICKGLWSLLKLHARNCRDSKCTVPKCSGLRAISRRKQQQADKRRRAA
VMEMMRERAAEATRTG

MAQGQNRTVLQSGQMHNSVVASASSVSSQPNMVNGISQDTLLLRQEMLNRTYAWLQQRQP
SKTDDASKAKLSEVAKRLESAMWRTATSKEDYLDFRSFDVRVESTLKQLLSQRRANPSSS
VSTMVQTPGVSHGWGQSYTATPMVDTSKFNSSNNLSDATTETGRLLPTNRMYRGTINNGR
QELSAVGQMIPTPGFDNSANADVYQSHRNEEYSGDGGKLLATGSDFGNPSQLQKQRPTGS
NDLMGYNLDHQLGGGFRSNIHQNTSGMTSIPLNAGVGMSGNNVHLANVPRSSEGVLSSTH
FSTFSQPSQQPVEQLQVSHVNRYSMSNSGTFVSGNLYGVQTSSGSIETAVDMNSMSLNSM
RRVDTSFGSQSGLQNNPLLKPHLRHQFENGNFQSSSNSKENLAQVSHRPLERQFNQQAHY
GQYHQQELLMNNDAYRQSQPASNLVSQVKNEPRVEYYNEAFQMQAINKVEPSKPQNQYKQ
NTVKDEYVGAQSAPVSSSQLKMSPSFPPQTHQTQQVSQWKDSSSLSAGVQPVSGLGQWHS
SSQNLTPISKNSNEEREHFGVRFHKQHEGTNNSSSVRESTNCLTVAPSGTLDVPHLPVGI
NVLSKQLNGDCGLSYKNQRRWLLFLLHVRKCNAAEDNCESKYCFTAKTLLKHINCCKAPA
CAYQYCHQTRQLIHHYKHCGDEACPVCVFVKNFKEKQKEKFTFLQRAEPSSASLNHGPKE
SFESMRTSSERDSEAPFVVDDLQPSPKRQKVEKPSQFAYPDTQGNPATISAGVSQAHFSM
GLQEKDRLPSDVCKPVRSNVPMNADSSDSSRRLVPVSRELEKPVCKDTHMGRHGVKSALD
GESLRLSKQEKPKRMNEISAPKEENAEQSLGVVSASNCGKSKIKGVSLIELFTPEQVEEH
IRGLRQWVGQSKTKAEKNKAMGLSMSENSCQLCAVERLAFEPTPIYCTPCGARVKRNAMH
YTVVAGESRHYVCIPCYNEARANTVSVDGTPVPKSRFEKKKNDEEVEESWVQCDKCQAWQ
HQICALFNGRRNHGQAEYTCPNCYIQEVEQGERKPVSQNVILGAKSLPASTLSNHLEQRL
FKKLKQERQERARLQGKSYEEVPGADSLVIRVVASVDKILEVKPRFLDIFREDNYSSEFP
YKSKAILLFQKIEGVEVCLFGMYVQEFGTDSASPNQRRVYLSYLDSVKYFRPDVRTVSGE
ALRTFVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKTDKLREWY
LAMLKKASKEKVVVECTNFYDHFFVQSGECRAKVTAARLPYFDGDYWPGAAEDLIDQMSQ
EEDGKKSNRKLMPKKVISKRALKAVGQLDLSVNASKDLLLMHKLGEIILPMKEDFIMVHL
QHCCKHCCTLMVSGNRWVCNQCKNFQICDKCHEVEENRVEKEKHPVNQKEKHVLYPVAID
NIPTEIKDNDDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMILYHLHNPTVPAF
AMACAICQQELETAQGWRCEVCPDYDVCNACYSKGINHPHSIISRPSATDSVVQNTQTNQ
IQNAQLREVLLHVMTCCTAQCQYPRCRVIKGLIRHGLVCKTRGCIACKKMWSLFRLHSRN
CRDPQCKVPKCRELRAHFSRKQQQADSRRRAAVMEMVRQRAADTTASTPE

www.000webhost.com

Other information
Ka divergence:-0.274908KaKs divergence:-0.0599583
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):4371Length 2 (bp):5013Length divergence:0.068
MFE 1 (kcal):-1252.66MFE 2 (kcal):-1541.34MFE divergence0.103