Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G56110-AT3G12860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homolog of nucleolar protein NOP56
Function (paralog2):NOP56-like pre RNA processing ribonucleoprotein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.6580416844642
Log2 mRNA fold difference:-3.6440891433367
Log2 TE fold difference:0.02981348833974
Sequences
Protein sequence

MAMYVIYESSSGYGLFEVHGLDEIGQNTEAVRTSVSDLSRFGRVVQLTAFHPFESALDAL
NQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGLAEPKLGSHIFEATKIPCQSNEF
VLELLRGVRQHFDRFIKDLKPGDLEKSQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT
LDKDINSFAMRVREWYSWHFPELVKIVNDNYLYARVSKMIDDKSKLTEDHIPMLTEVLGD
EDKAKEVIEAGKASMGSDLSPLDLINVQTFAQKVMDLADYRKKLYDYLVTKMSDIAPNLA
ALIGEMVGARLISHAGSLTNLAKCPSSTLQILGAEKALFRALKTRGNTPKYGLIFHSSFI
GRASAKNKGRIARYLANKCSIASRIDCFADGATTAFGEKLREQVEERLEFYDKGVAPRKN
VDVMKEVIENLKQEEEGKEPVDASVKKSKKKKAKGEEEEEVVAMEEDKSEKKKKKEKRKM
ETAEENEKSEKKKTKKSKAGGEEETDDGHSTKKKKKKSKSAE

MKIYLLSESPSGYGLFEGHGSDEIGQNTEAVRSSVSDLSRFGRVVQLTAFHPFQSALDAL
NQINAVSEGYMSDELRSFLELNLPKVKEGKKPKFSLGVSEPKIGSCIFEATKIPCQSNEF
VHELLRGVRQHFDRFIKDLKPGDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFMLDT
LDKDINSFAMRVREWYSWHFPELVKIVNDNYLYAKVSKIIVDKSKLSEEHIPMLTEALGD
EDKAREVIEAGKASMGQDLSPVDLINVQTFAQRVMDLADYRKKLYDYLVTKMSDIAPNLA
ALIGEMVGARLISHAGSLTNLAKCPSSTLQILGAEKALFRALKTRGNTPKYGLIFHSSFI
GRASAKNKGRIARFLANKCSIASRIDCFSDNSTTAFGEKLREQVEERLDFYDKGVAPRKN
VDVMKEVLENLEKKDEGEKTVDASEKKKKRKTEEKEEEKEEEKSKKKKKKSKAVEGEELT
ATDNGHSKKKKKTKSQDDE

Other information
Ka divergence:0.162053KaKs divergence:0.47032
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1569Length 2 (bp):1500Length divergence:-0.022
MFE 1 (kcal):-480.99MFE 2 (kcal):-458.64MFE divergence-0.024