Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G56120-AT1G56130
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Leucine-rich repeat transmembrane protein kinase
Function (paralog2):Leucine-rich repeat transmembrane protein kinase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2581953273916
Log2 mRNA fold difference:0.87015428394308
Log2 TE fold difference:0.64498339920162
Sequences
Protein sequence

MVRAQNRTRPTTHPDDARALNSIFAAWKIRAPREWNISGELCSGVAIDASVLDSNHAYNP
LIKCDCSFQNSTICRINNIKVYAIDVVGPIPPELWTLTYLTNLNLGQNYLTGSLSPAIGN
LTRMQWMTFGINALSGPIPKEIGLLTDLRLLGISSNNFSGSLPAEIGSCTKLQQMYIDSS
GLSGGIPLSFANFVELEVAWIMDVELTGRIPDFIGFWTKLTTLRILGTGLSGPIPSSFSN
LIALTELRLGDISNGSSSLDFIKDMKSLSVLVLRNNNLTGTIPSTIGGYTSLQQVDLSFN
KLHGPIPASLFNLSRLTHLFLGNNTLNGSLPTLKGQSLSNLDVSYNDLSGSLPSWVSLPD
LKLNLVANNFTLEGLDNRVLSGLHCLQKNFPCNRGEGICKCNKKIPSQIMFSMLNVQTYG
QGSNVLLEKNCFKTFAIDWCLDYNFSINCGGPEIRSVSGALFEKEDADLGPASFVVSAAK
RWAASSVGNFAGSSNNIYIATSLAQFINTMDSELFQSARLSASSLRYYGLGLENGGYTVT
LQFAEVQIEGSNSWKGIGRRRFNIYVQGRLVEKDFDIRRTAGGSSVRAVQREYKTNVSEN
HLEVHLFWAGKGTCCIPIQGAYGPLIAAVSATPDFTPTVANRPPSKGKSRTGTIVGVIVG
VGLLSIFAGVVILVIRKRRKPYTDDEEILSMDVKPYTFTYSELKNATQDFDLSNKLGEGG
FGAVYKGNLNDGREVAVKQLSIGSRQGKGQFVAEIIAISSVLHRNLVKLYGCCFEGDHRL
LVYEYLPNGSLDQALFGDKSLHLDWSTRYEICLGVARGLVYLHEEASVRIIHRDVKASNI
LLDSELVPKVSDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVA
LELVSGRKNSDENLEEGKKYLLEWAWNLHEKNRDVELIDDELSEYNMEEVKRMIGIALLC
TQSSYALRPPMSRVVAMLSGDAEVNDATSKPGYLTDCTFDDTTSSSFSNFQTKDTSFSTS
FIAPGPEMPLRDGESKPMVGFKIKEGR

MTRIRRSPCLLLLIIWFMCIAGSVQVVQSQNQTGATTHPDEARALNSIFAAWKIQAPREW
NISGELCSGAAIDASVLDSNPAYNPLIKCDCSFQNSTICRITNIKVYAIDVVGPIPPELW
TLTYLTNLNLGQNVLTGSLPPAIGNLTRMQWMTFGINALSGPVPKEIGLLTDLRLLGISS
NNFSGSIPDEIGRCTKLQQMYIDSSGLSGRIPLSFANLVQLEQAWIADLEVTDQIPDFIG
DWTKLTTLRIIGTGLSGPIPSSFSNLTSLTELRLGDISSGSSSLDFIKDMKSLSVLVLRN
NNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQKT
QSLRNVDVSYNDLSGSLPSWVSLPSLKLNLVANNFTLEGLDNRVLPGLNCLQKNFPCNRG
KGIYSDFSINCGGPEKRSVTGALFEREDEDFGPASFFVSAGQRWAASSVGLFAGSSNNIY
IATSQSQFVNTLDSELFQSARLSASSVRYYGLGLENGGYTVTLQFAEIQILGSTSTTWKG
LGRRRFDIYVQGRLVEKDFDVRRTAGDSTVRAVQRVYKANVSENHLEVHLFWAGKGTCCI
PIQGAYGPLISAVSATPDFTPTVANKPPSKGKNRTGTIVGVIVGVGLLSILAGVVMFTIR
KRRKRYTDDEELLGMDVKPYIFTYSELKSATQDFDPSNKLGEGGFGPVYKGNLNDGRVVA
VKLLSVGSRQGKGQFVAEIVAISSVLHRNLVKLYGCCFEGEHRMLVYEYLPNGSLDQALF
GDKTLHLDWSTRYEICLGVARGLVYLHEEASVRIVHRDVKASNILLDSRLVPQISDFGLA
KLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSGRPNSDENLEE
EKKYLLEWAWNLHEKSRDIELIDDKLTDFNMEEAKRMIGIALLCTQTSHALRPPMSRVVA
MLSGDVEIGDVTSKPGYVSDWRFDDTTGSSLSGFQIKDTTGYSMSLVAPGSEISPRDSDF
KPMLGSKINEGR

Other information
Ka divergence:-0.210113KaKs divergence:0.183339
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):3144Length 2 (bp):3099Length divergence:-0.007
MFE 1 (kcal):-949.11MFE 2 (kcal):-957.65MFE divergence0.004